Vps36 (vacuolar protein sorting 36 homolog)

Gene: Vps36 (vacuolar protein sorting 36 homolog) Rattus norvegicus

Analyze

Symbol:

Vps36

Name:

vacuolar protein sorting 36 homolog

RGD ID:

1309754

Description:

Predicted to enable ubiquitin binding activity. Predicted to be involved in protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway. Predicted to be located in cytosol; late endosome; and lysosome. Predicted to be part of ESCRT II complex. Predicted to be active in late endosome membrane. Orthologous to human VPS36 (vacuolar protein sorting 36 homolog); PARTICIPATES IN endocytosis pathway; INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ELL-associated protein of 45 kDa; ESCRT-II complex subunit VPS36; LOC290851; RGD1309754; similar to RIKEN cDNA 2210415M20; vacuolar protein sorting 36; vacuolar protein sorting 36 (yeast); vacuolar protein sorting 36 homolog (S. cerevisiae); vacuolar protein-sorting-associated protein 36

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	VPS36 (vacuolar protein sorting 36 homolog)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Vps36 (vacuolar protein sorting 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Vps36 (vacuolar protein sorting 36 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	VPS36 (vacuolar protein sorting 36 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	VPS36 (vacuolar protein sorting 36 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Vps36 (vacuolar protein sorting 36 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	VPS36 (vacuolar protein sorting 36 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	VPS36 (vacuolar protein sorting 36 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Vps36 (vacuolar protein sorting 36 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	VPS36 (vacuolar protein sorting 36 homolog)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Vps36 (vacuolar protein sorting 36)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	vps36 (vacuolar protein sorting 36 homolog)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	VPS36	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Vps36	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	vps-36	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	vps36	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	76,512,851 - 76,537,235 (-)	NCBI		GRCr8
mRatBN7.2	16	69,810,404 - 69,834,789 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	69,808,193 - 69,834,810 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	75,084,083 - 75,108,470 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	78,522,770 - 78,547,313 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	73,772,051 - 73,796,601 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	74,719,642 - 74,743,921 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	74,719,553 - 74,743,927 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	74,355,181 - 74,378,989 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	74,462,427 - 74,486,889 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	74,462,685 - 74,487,153 (-)	NCBI
Celera	16	67,699,712 - 67,723,982 (-)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 13q14 deletion syndrome (ISO)

genetic disease (ISO)

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,6-tribromophenol (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

aflatoxin B1 (EXP,ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

ivermectin (ISO)

ketamine (EXP)

lead diacetate (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

paracetamol (EXP,ISO)

potassium chromate (ISO)

quercetin (ISO)

resveratrol (ISO)

senecionine (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway (IBA,IEA)

Cellular Component

cytosol (ISO)

endosome (ISO,ISS)

ESCRT II complex (IBA,IEA,ISO)

late endosome (ISO)

late endosome membrane (IBA,IEA,ISO)

lysosome (IEA,ISO)

nucleus (IEA)

Molecular Function

phosphatidylinositol-3-phosphate binding (IEA)

protein binding (ISO)

ubiquitin binding (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

endocytosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11278625	PMID:12477932	PMID:15057822	PMID:15755741	PMID:16973552	PMID:17010938	PMID:19056867	PMID:20682791	PMID:22871113	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Vps36
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	76,512,851 - 76,537,235 (-)	NCBI		GRCr8
mRatBN7.2	16	69,810,404 - 69,834,789 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	69,808,193 - 69,834,810 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	75,084,083 - 75,108,470 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	78,522,770 - 78,547,313 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	73,772,051 - 73,796,601 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	74,719,642 - 74,743,921 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	74,719,553 - 74,743,927 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	74,355,181 - 74,378,989 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	74,462,427 - 74,486,889 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	74,462,685 - 74,487,153 (-)	NCBI
Celera	16	67,699,712 - 67,723,982 (-)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

VPS36
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	52,412,606 - 52,450,634 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	52,412,602 - 52,450,634 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	52,986,741 - 53,024,769 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	51,884,738 - 51,922,764 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	13	51,887,319 - 51,922,735	NCBI
Celera	13	33,972,434 - 34,010,460 (+)	NCBI		Celera
Cytogenetic Map	13	q14.3	NCBI
HuRef	13	33,725,057 - 33,763,914 (-)	NCBI		HuRef
CHM1_1	13	52,954,794 - 52,992,839 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	13	51,627,427 - 51,665,457 (-)	NCBI		T2T-CHM13v2.0

Vps36
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	22,682,849 - 22,710,969 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	22,682,825 - 22,710,859 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	22,192,833 - 22,220,953 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	22,192,809 - 22,220,843 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	23,303,332 - 23,329,069 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	23,658,405 - 23,684,142 (+)	NCBI		MGSCv36	mm8
Celera	8	23,685,519 - 23,711,451 (+)	NCBI		Celera
Cytogenetic Map	8	A2	NCBI
cM Map	8	11.14	NCBI

Vps36
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955431	5,443,050 - 5,463,366 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955431	5,443,050 - 5,466,577 (+)	NCBI	ChiLan1.0	ChiLan1.0

VPS36
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	53,701,390 - 53,739,422 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	52,345,676 - 52,383,673 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	33,398,165 - 33,436,615 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	52,336,484 - 52,372,851 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	52,336,484 - 52,372,851 (-)	Ensembl	panpan1.1		panPan2

VPS36
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	150,984 - 191,531 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	150,150 - 191,544 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	270,159 - 314,363 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	253,768 - 297,980 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	25	134,622 - 178,867 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	149,317 - 193,530 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	217,148 - 261,346 (+)	NCBI		UU_Cfam_GSD_1.0

Vps36
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	161,414,915 - 161,437,361 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936565	4,898,969 - 4,921,411 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

VPS36
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	15,701,373 - 15,735,474 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	15,701,370 - 15,735,469 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	15,968,921 - 16,003,061 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

VPS36
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	30,112,245 - 30,147,976 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	30,112,322 - 30,145,275 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666057	13,667,873 - 13,701,090 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Vps36
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624748	1,881,411 - 1,908,505 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624748	1,880,542 - 1,908,541 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Vps36
339 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	11
Count of miRNA genes:	10
Interacting mature miRNAs:	11
Transcripts:	ENSRNOT00000016995
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat
1298527	Arunc2	Aerobic running capacity QTL 2	2.9		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	68532716	75029966	Rat

Markers in Region

RH130023

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	69,810,086 - 69,810,270 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	74,719,325 - 74,719,508	NCBI	Rnor6.0
Rnor_5.0	16	74,354,864 - 74,355,047	UniSTS	Rnor5.0
RGSC_v3.4	16	74,462,110 - 74,462,293	UniSTS	RGSC3.4
Celera	16	67,699,395 - 67,699,578	UniSTS
RH 3.4 Map	16	663.21	UniSTS
Cytogenetic Map	16	q12.5	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	56	40	19	40	8	11	74	35	41	11	8
Low			1	1		1
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC160860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000016995 ⟹ ENSRNOP00000016995

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	69,808,193 - 69,834,795 (-)	Ensembl
Rnor_6.0 Ensembl	16	74,719,553 - 74,743,927 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000094456 ⟹ ENSRNOP00000077525

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	69,808,193 - 69,834,810 (-)	Ensembl

RefSeq Acc Id:

NM_001106092 ⟹ NP_001099562

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	76,512,851 - 76,537,235 (-)	NCBI
mRatBN7.2	16	69,810,404 - 69,834,789 (-)	NCBI
Rnor_6.0	16	74,719,642 - 74,743,921 (-)	NCBI
Rnor_5.0	16	74,355,181 - 74,378,989 (-)	NCBI
RGSC_v3.4	16	74,462,427 - 74,486,889 (-)	RGD
Celera	16	67,699,712 - 67,723,982 (-)	RGD

Sequence:

show sequence

GCGGCAGAGGCCGGCCGGGTGGCGGCCATGGACCGCTTCGTGTGGACCAGCGGCCTCCTGGAGA
TCAACGAGACCCTGGTGATCCAGCAGCGAGGAGTGCGCGTCTACGACGGCGAGGAGAAGATAAA
ATTTGATGCTGGGACTCTTCTCCTTAGTACACACCGGCTGATTTGGAGAGACCAGAAAAACAAT
GAGTGCTGCATGGCCATTCCCCTATCGCAGATTGTGTTCATCGAGGAGCAGGCGGCTGGAATTG
GGAAGAGTGCCAAAATCGTGGTTCATCTGCACCCAGCCCCTCCTAACAAAGAACCCGGCCCATT
CCAGAGCAGTAAGAACTCCTACATCAAGCTCTCCTTCAAAGAGCATGGTCAGATCGAGTTTTAC
AGGCGTTTATCAGAGGAGATGACCCAAAGAAGATGGGAGACAGTGCCAGTTTCCCAGTCACTAC
AAACAAAGAAAGGACCCCAGCCAGGAAGAATAAGAGCTGTTGGAATTGTAGGCATTGAAAGGAA
ACTTGAAGAAAAAAGGAAAGAAACAGACAAAAACATTTCTGAGGCCTTTGAAGACCTGAGCAAG
CTGATGATCAAGGCTAAGGAAATGGTAGAGTTATCAAAATCGATCGCTAATAAGATTAAAGAGA
AGCAAGGCGATGTCACAGAAGACGAGACCATCAGGTTTAAGTCGTACTTGCTGAGCATGGGAAT
AGCCAACCCAGTCACCAGAGAAACCTATGGCTCAGGCACACAGTACCACATGCAACTGGCCAAG
CAGCTGGCCGGGATATTGCAGGCTCCCTTGGAGGAGCGTGGGGGAATAATGTCACTCACAGAGG
TGTACTGTTTAGTGAACCGAGCCCGAGGAATGGAGTTGCTCTCACCAGAAGACTTAGTAAATGC
ATGCAAGATGCTGGAAGGCCTGAAACTGCCTGTCAGACTCCGGGTTTTCGACAGTGGTGTCATG
GTAATTGAGCTTCAGACTCACAAGGAAGAGGAAATGGTGGCCTCGGCCTTAGAGACGGTTTCCG
AGAGGGGATCCTTAACATCAGAAGAGTTTGCCAAGCTTGTGGGAATGTCTGTCCTTCTGGCTAA
AGAAAGGCTGCTTCTTGCGGAGAAGATGGGCCACCTTTGCCGAGATGACTCTGTGGAAGGCTTG
CGGTTTTATCCAAATTTATTTATGACACAGAACTAAGAATCCCGTACTTGAAATATTTTTTGTC
AATATGCTTACATTATGCCAACATCTCATGACACTGAGTTAAGAGATAAACTCAAATAAACCAA
GAATTTATTAGAACCTCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099562	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI60860	(Get FASTA)	NCBI Sequence Viewer
	EDM08991	(Get FASTA)	NCBI Sequence Viewer
	EDM08992	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016995
	ENSRNOP00000016995.5
	ENSRNOP00000077525.1
GenBank Protein	P0C0A2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001099562 ⟸ NM_001106092

- UniProtKB:

P0C0A2 (UniProtKB/Swiss-Prot), B1H248 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDRFVWTSGLLEINETLVIQQRGVRVYDGEEKIKFDAGTLLLSTHRLIWRDQKNNECCMAIPLS
QIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQ
RRWETVPVSQSLQTKKGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMV
ELSKSIANKIKEKQGDVTEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQAP
LEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEGLKLPVRLRVFDSGVMVIELQTHKE
EEMVASALETVSERGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMT
QN

hide sequence

RefSeq Acc Id:

ENSRNOP00000016995 ⟸ ENSRNOT00000016995

RefSeq Acc Id:

ENSRNOP00000077525 ⟸ ENSRNOT00000094456

Protein Domains

GLUE C-terminal GLUE N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P0C0A2-F1-model_v2	AlphaFold	P0C0A2	1-386	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700192

Promoter ID:

EPDNEW_R10716

Type:

multiple initiation site

Name:

Vps36_1

Description:

vacuolar protein sorting 36 homolog

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	74,743,923 - 74,743,983	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309754	AgrOrtholog
BioCyc Gene	G2FUF-10863	BioCyc
Ensembl Genes	ENSRNOG00000012654	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016995	ENTREZGENE
	ENSRNOT00000016995.8	UniProtKB/TrEMBL
	ENSRNOT00000094456.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.30.29.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	6.10.140.260	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7321877	IMAGE-MGC_LOAD
InterPro	GLUE_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PH-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Snf8/Vps36	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Vps36	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:290851	UniProtKB/TrEMBL
MGC_CLONE	MGC:188216	IMAGE-MGC_LOAD
NCBI Gene	290851	ENTREZGENE
PANTHER	PTHR13128	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VACUOLAR PROTEIN-SORTING-ASSOCIATED PROTEIN 36	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	EAP30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Vps36_ESCRT-II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Vps36	PhenoGen
PROSITE	GLUE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012654	RatGTEx
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF46785	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5Y1N8_RAT	UniProtKB/TrEMBL
	B1H248	ENTREZGENE, UniProtKB/TrEMBL
	P0C0A2	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-04-19	Vps36	vacuolar protein sorting 36 homolog	Vps36	vacuolar protein sorting 36	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-04-13	Vps36	vacuolar protein sorting 36	Vps36	vacuolar protein sorting 36 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Vps36	vacuolar protein sorting 36 homolog (S. cerevisiae)	Vps36	vacuolar protein sorting 36 (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Vps36	vacuolar protein sorting 36 (yeast)	Vps36_predicted	vacuolar protein sorting 36 (yeast) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Vps36_predicted	vacuolar protein sorting 36 (yeast) (predicted)	RGD1309754_predicted	similar to RIKEN cDNA 2210415M20 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1309754_predicted	similar to RIKEN cDNA 2210415M20 (predicted)	LOC290851_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC290851_predicted	similar to RIKEN cDNA 2210415M20 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)