Fbxo5 (F-box protein 5) - Rat Genome Database

Name: Fbxo5
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Fbxo5 (F-box protein 5) Rattus norvegicus

Analyze

Symbol:

Fbxo5

Name:

F-box protein 5

RGD ID:

1309405

Description:

Predicted to enable anaphase-promoting complex binding activity; protein kinase binding activity; and ubiquitin ligase inhibitor activity. Predicted to be involved in several processes, including negative regulation of cellular senescence; positive regulation of mesenchymal stem cell migration; and regulation of cell cycle process. Predicted to act upstream of or within several processes, including female gamete generation; microtubule polymerization; and regulation of meiotic nuclear division. Predicted to be located in cytoplasm; meiotic spindle; and nucleoplasm. Predicted to be active in nucleus. Orthologous to human FBXO5 (F-box protein 5); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

F-box only protein 5; LOC292263

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FBXO5 (F-box protein 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Fbxo5 (F-box protein 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fbxo5 (F-box protein 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FBXO5 (F-box protein 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FBXO5 (F-box protein 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fbxo5 (F-box protein 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FBXO5 (F-box protein 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FBXO5 (F-box protein 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fbxo5 (F-box protein 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FBXO5 (F-box protein 5)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fbxo5 (F-box protein 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fbxo5 (F-box protein 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rca1	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	fbxo5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	44,601,412 - 44,607,781 (-)	NCBI		GRCr8
mRatBN7.2	1	42,196,068 - 42,202,437 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	42,196,068 - 42,202,437 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	42,738,271 - 42,744,646 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	48,725,464 - 48,731,839 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	42,813,736 - 42,820,111 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	42,461,277 - 42,467,646 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	42,461,291 - 42,467,586 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	43,791,187 - 43,797,556 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	36,492,134 - 36,498,503 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	36,495,551 - 36,501,323 (-)	NCBI
Celera	1	37,863,352 - 37,869,721 (-)	NCBI		Celera
Cytogenetic Map	1	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive spinocerebellar ataxia 8 (ISO)

chromosome 6q24-q25 deletion syndrome (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

2-palmitoylglycerol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

caffeine (ISO)

calcitriol (ISO)

captan (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

crotonaldehyde (ISO)

CU-O LINKAGE (ISO)

cyclosporin A (ISO)

diazinon (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (ISO)

diclofenac (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

Echimidine (ISO)

Enterolactone (ISO)

folpet (ISO)

fulvestrant (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

geraniol (ISO)

hydroquinone (ISO)

Lasiocarpine (ISO)

leflunomide (ISO)

lidocaine (EXP)

lucanthone (ISO)

methyl methanesulfonate (ISO)

monocrotaline (ISO)

N(4)-hydroxycytidine (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N-nitrosourea (ISO)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nocodazole (ISO)

oxaliplatin (EXP)

ozone (ISO)

paclitaxel (ISO)

palbociclib (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

propanal (ISO)

quercetin (ISO)

resveratrol (ISO)

riddelliine (ISO)

rotenone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sirolimus (ISO)

sodium dichromate (EXP,ISO)

sodium dodecyl sulfate (ISO)

sunitinib (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

trovafloxacin (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vanadyl sulfate (ISO)

vincristine (ISO)

zaragozic acid A (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell division (IEA)

DNA damage response (ISO)

microtubule polymerization (ISO)

negative regulation of cellular senescence (ISO)

negative regulation of DNA endoreduplication (ISO)

negative regulation of meiotic nuclear division (IBA,ISO)

negative regulation of mitotic metaphase/anaphase transition (ISO)

oocyte maturation (ISO)

positive regulation of biomineral tissue development (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of G2/M transition of mitotic cell cycle (ISO)

positive regulation of mesenchymal stem cell migration (ISO)

positive regulation of osteoblast differentiation (ISO)

protein ubiquitination (IEA)

regulation of DNA replication (ISO)

regulation of meiotic nuclear division (ISO)

regulation of mitotic cell cycle (ISO)

regulation of mitotic nuclear division (IBA)

spindle assembly (ISO)

spindle assembly involved in female meiosis I (ISO)

vesicle organization (ISO)

Cellular Component

cytoplasm (ISO)

meiotic spindle (ISO)

nucleoplasm (ISO)

nucleus (IBA,ISO)

spindle (ISO)

Molecular Function

anaphase-promoting complex binding (ISO)

metal ion binding (IEA)

molecular function inhibitor activity (ISO)

protein binding (ISO)

protein kinase binding (ISO)

ubiquitin ligase inhibitor activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11988738	PMID:12477932	PMID:15148369	PMID:15469984	PMID:15526037	PMID:16809773	PMID:16921029	PMID:17190794	PMID:17234884	PMID:17485488	PMID:17875940	PMID:23708001
PMID:23708605	PMID:24615569	PMID:26083744	PMID:29850565	PMID:29875408

Genomics

Comparative Map Data

Fbxo5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	44,601,412 - 44,607,781 (-)	NCBI		GRCr8
mRatBN7.2	1	42,196,068 - 42,202,437 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	42,196,068 - 42,202,437 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	42,738,271 - 42,744,646 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	48,725,464 - 48,731,839 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	42,813,736 - 42,820,111 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	42,461,277 - 42,467,646 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	42,461,291 - 42,467,586 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	43,791,187 - 43,797,556 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	36,492,134 - 36,498,503 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	36,495,551 - 36,501,323 (-)	NCBI
Celera	1	37,863,352 - 37,869,721 (-)	NCBI		Celera
Cytogenetic Map	1	q11	NCBI

FBXO5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	152,970,535 - 152,983,579 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	152,970,519 - 152,983,579 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	153,291,670 - 153,304,714 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	153,333,351 - 153,345,867 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	153,383,773 - 153,396,288	NCBI
Celera	6	154,025,328 - 154,038,410 (-)	NCBI		Celera
Cytogenetic Map	6	q25.2	NCBI
HuRef	6	150,854,447 - 150,867,531 (-)	NCBI		HuRef
CHM1_1	6	153,555,576 - 153,568,660 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	154,171,829 - 154,184,878 (-)	NCBI		T2T-CHM13v2.0

Fbxo5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	5,749,155 - 5,755,465 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	5,749,160 - 5,755,600 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	5,799,158 - 5,805,465 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	5,799,160 - 5,805,600 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	4,541,076 - 4,547,383 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	4,541,076 - 4,546,998 (+)	NCBI		MGSCv36	mm8
Celera	10	5,733,112 - 5,739,409 (-)	NCBI		Celera
Cytogenetic Map	10	A1	NCBI
cM Map	10	1.91	NCBI

Fbxo5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955439	8,830,975 - 8,843,828 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955439	8,830,658 - 8,843,653 (+)	NCBI	ChiLan1.0	ChiLan1.0

FBXO5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	172,999,614 - 173,012,769 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	170,892,462 - 170,905,617 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	150,793,020 - 150,806,008 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	155,481,767 - 155,494,689 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	155,481,753 - 155,494,231 (-)	Ensembl	panpan1.1		panPan2

FBXO5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	43,138,338 - 43,149,546 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	43,138,889 - 43,149,297 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	43,975,851 - 43,987,186 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	43,321,686 - 43,333,047 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	43,322,263 - 43,332,336 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	43,189,124 - 43,200,485 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	43,052,605 - 43,063,915 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	43,540,287 - 43,551,650 (-)	NCBI		UU_Cfam_GSD_1.0

Fbxo5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	138,337,977 - 138,349,305 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936489	5,589,538 - 5,600,539 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936489	5,589,621 - 5,602,221 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FBXO5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	13,467,501 - 13,505,928 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	13,466,961 - 13,478,496 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	15,716,714 - 15,728,617 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FBXO5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	80,453,345 - 80,467,590 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	80,453,355 - 80,466,778 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	52,778,853 - 52,792,908 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fbxo5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624785	5,247,731 - 5,260,736 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624785	5,248,434 - 5,260,623 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fbxo5
15 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	339
Count of miRNA genes:	191
Interacting mature miRNAs:	219
Transcripts:	ENSRNOT00000029416
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	15431621	49361612	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	0.00000072	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	15431621	49361612	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	16206210	49268520	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	20763158	44095856	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1357397	Bw41	Body weight QTL 41	4.19	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat

Markers in Region

RH127160

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	42,196,595 - 42,196,840 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	42,461,805 - 42,462,049	NCBI	Rnor6.0
Rnor_5.0	1	43,791,715 - 43,791,959	UniSTS	Rnor5.0
RGSC_v3.4	1	36,492,662 - 36,492,906	UniSTS	RGSC3.4
Celera	1	37,863,880 - 37,864,124	UniSTS
Cytogenetic Map	1	p11	UniSTS

RH143642

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	42,199,124 - 42,199,224 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	42,464,334 - 42,464,433	NCBI	Rnor6.0
Rnor_5.0	1	43,794,244 - 43,794,343	UniSTS	Rnor5.0
RGSC_v3.4	1	36,495,191 - 36,495,290	UniSTS	RGSC3.4
Celera	1	37,866,409 - 37,866,508	UniSTS
RH 3.4 Map	1	441.0	UniSTS
Cytogenetic Map	1	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	26	29	22	16	22			37	20	30
Low	1	16	28	19	3	19	6	6	37	15	9	11	6
Below cutoff		1					2	5			2		2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474052	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000029416 ⟹ ENSRNOP00000034853

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	42,196,068 - 42,202,437 (-)	Ensembl
Rnor_6.0 Ensembl	1	42,461,291 - 42,467,586 (-)	Ensembl

RefSeq Acc Id:

NM_001106206 ⟹ NP_001099676

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	44,601,412 - 44,607,781 (-)	NCBI
mRatBN7.2	1	42,196,068 - 42,202,437 (-)	NCBI
Rnor_6.0	1	42,461,277 - 42,467,646 (-)	NCBI
Rnor_5.0	1	43,791,187 - 43,797,556 (-)	NCBI
RGSC_v3.4	1	36,492,134 - 36,498,503 (-)	RGD
Celera	1	37,863,352 - 37,869,721 (-)	RGD

Sequence:

show sequence

GAAATTCAAAGATTTTAAAAGTACCAGCTGGCGCCTTTTAAGAGCTACAGCTCGGCGCCGCGGC
TAGCCACCTCTCTCTTGTGGTCGCCGCCACCTCACCTGCATTGGAACCCAAGTTTTCCGGCATG
AGCCGGCGCGCCTGCGGTGATCTCCCCCGGCCGTCCTCCTGTCTCTGCCCTCTTGACGCGCGGA
CGACCGTGGACGGTTGTAAAGAAGAAAGCCCTGTTCTTTCGGTTACCATGAAGTGTTTTAATTG
CAACCCTGATCTTTTGGAGCTTGAGGTGGTGAAGACTGAGGACAGTGGGAGGGAAGGTTCCTAC
AGTCCTGTGTGTTTGGAACCTTCCTGTGACAATTGTGTTGGAAACCATGAAAGATTGTCTTTTG
TCGAATCACCAATTGTGGGACATGATAACAAGGAAAATCAACGTGTACAAAATATACTAGATAG
TTCAAAGGAAGTGGAAGAGCTGGAGGCCAGCAGACTGTATGAGGACAGCGGCTACTCCTCATTC
ATACAGAGTGACAGTGACGATGGCATCCTTATCCTGGAGAATTTCAGAAACAGTTCCCAGGCCC
ATCTGCTGCTGTCATCGCAGAGCCCAGACCAGCATCCCAACAAAAACCTGCTGCCTGCCCTGCA
TTTTGAAAGAGTGGTTTGCTCAACATTAAAAAAGAATGGCAAGCGAAACTCTAAAGTGGATCAA
GAAATGCTGAAGGAAGTTATCGCCAGCGGAAACATTACACTGCAAAATATAATTGGCAAGAAAA
TGGGCCTGGAACACCTAGATATCCTGGCTGAGCTCTCCCGGAGGGGATGTATGCACCTGTTAGC
TAATATTTTCATGAAGCTCAGCGGCATGGACTTAATAAATTTGTCTAAAGTGAGCAGAATTTGG
AAGAAGATACTAGAAAGCGATAAAGGAGCATTCCAGCAATACAGCAAAGCCATGCAGAGAGTCA
TTGAAAGCAATAAGTTGTCACTACATGCTTCAACCAGAGGATATGTCGTGGGCAGAACTGCACT
AACCTGTGTTCAAAAGTCATCGACCTGGGCACCTCCCAAAAATGTTCAACCCAGTCAACGTGGT
CAGAGGGGTTCTGTCTACAGCCGGCACAATGAGTTCCTGGAGGTGGCAAAGACATTGAAAAACA
ACGAAAGCCTCAAAGCCTGTGTTCGCTGTAATTTCCCTGCAAAATATGACCATTATTTAGAGCG
AGCAGTCTGCAAACGGGAAAGTTGTAAATTCGAATATTGTACAAAGTGTCTGTGTGCTTACCAT
AACAACAAAGACTGTTTGAATAGCAAGAACCTAAAAGCCAGCTGCAAAATGGGTCCTTTGCCTG
GAACTAAAAAGAGTAAAAAGAACTTACAAAGATTGTGACCTTTTAGTCGATCAACTGTACATCG
TAAGGGCTACTTTAAAAGAAAAAAAAGAAAAGAAATCCGATTTTAACTTAAAGTAAATGTAATG
TTGATCCCTTTTGTGAATGGAGGACATACAGCCTCTTAAAATAATCACAGCTTAATGCTAAAAA
AATTAAATGTCCATAAAACACCAAGATTGACTTATGCAAAATTTATTTTATCTATTTGTAGTTA
CATGCTAAGACAAAATTGATTGGACTTTTTGGCAAGTGAAGTCTGGATTTTTTATGGAGTCTTG
AAAACAGATGTGCTTCAGTGTTAGCCTCTGAGACACGTTTTACCAAATTTGTATTATGTGCCTA
TCAACTTGAGTCTGTCAATTTAAATGTTTGTCAGTATGAGCTTTTCAGTGTTAAGTATCCTTTG
TAGAGTCCTGTTTATTTCTGAAGTCTATTTTAATGTTTTTATGTCTGTAAATATCTTATTATGT
ACCAAAGAAAAAAATAAACATAATTTTGTTACGATAATCTTGTCAGAGGTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099676	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58746	(Get FASTA)	NCBI Sequence Viewer
	EDL92840	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000034853
	ENSRNOP00000034853.4

RefSeq Acc Id:

NP_001099676 ⟸ NM_001106206

- UniProtKB:

B0BNA4 (UniProtKB/TrEMBL), A6KIN9 (UniProtKB/TrEMBL), F7EZD0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSRRACGDLPRPSSCLCPLDARTTVDGCKEESPVLSVTMKCFNCNPDLLELEVVKTEDSGREGS
YSPVCLEPSCDNCVGNHERLSFVESPIVGHDNKENQRVQNILDSSKEVEELEASRLYEDSGYSS
FIQSDSDDGILILENFRNSSQAHLLLSSQSPDQHPNKNLLPALHFERVVCSTLKKNGKRNSKVD
QEMLKEVIASGNITLQNIIGKKMGLEHLDILAELSRRGCMHLLANIFMKLSGMDLINLSKVSRI
WKKILESDKGAFQQYSKAMQRVIESNKLSLHASTRGYVVGRTALTCVQKSSTWAPPKNVQPSQR
GQRGSVYSRHNEFLEVAKTLKNNESLKACVRCNFPAKYDHYLERAVCKRESCKFEYCTKCLCAY
HNNKDCLNSKNLKASCKMGPLPGTKKSKKNLQRL

hide sequence

RefSeq Acc Id:

ENSRNOP00000034853 ⟸ ENSRNOT00000029416

Protein Domains

ZBR-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BNA4-F1-model_v2	AlphaFold	B0BNA4	1-418	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689591

Promoter ID:

EPDNEW_R116

Type:

multiple initiation site

Name:

Fbxo5_1

Description:

F-box protein 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	42,467,600 - 42,467,660	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309405	AgrOrtholog
BioCyc Gene	G2FUF-61699	BioCyc
Ensembl Genes	ENSRNOG00000024077	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000029416	ENTREZGENE
	ENSRNOT00000029416.7	UniProtKB/TrEMBL
Gene3D-CATH	2.20.25.20	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9100726	IMAGE-MGC_LOAD
InterPro	F-box_dom_cyclin-like	UniProtKB/TrEMBL
	F-box_dom_like	UniProtKB/TrEMBL
	FBX5_43	UniProtKB/TrEMBL
	ZF_ZBR	UniProtKB/TrEMBL
KEGG Report	rno:292263	UniProtKB/TrEMBL
MGC_CLONE	MGC:187924	IMAGE-MGC_LOAD
NCBI Gene	292263	ENTREZGENE
PANTHER	F-BOX ONLY PROTEIN 5	UniProtKB/TrEMBL
	F-BOX ONLY PROTEIN 5 AND 43	UniProtKB/TrEMBL
Pfam	F-box	UniProtKB/TrEMBL
PhenoGen	Fbxo5	PhenoGen
PROSITE	ZF_ZBR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000024077	RatGTEx
Superfamily-SCOP	SSF81383	UniProtKB/TrEMBL
UniProt	A6KIN9	ENTREZGENE, UniProtKB/TrEMBL
	B0BNA4	ENTREZGENE
	F7EZD0	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	B0BNA4	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Fbxo5	F-box protein 5	Fbxo5_predicted	F-box only protein 5 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Fbxo5_predicted	F-box only protein 5 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar