Rmdn3 (regulator of microtubule dynamics 3)

Gene: Rmdn3 (regulator of microtubule dynamics 3) Rattus norvegicus

Analyze

Symbol:

Rmdn3

Name:

regulator of microtubule dynamics 3

RGD ID:

1308697

Description:

Predicted to enable microtubule binding activity. Predicted to be involved in intracellular calcium ion homeostasis. Predicted to be located in intercellular bridge; mitochondrial outer membrane; and organelle membrane contact site. Predicted to be active in mitochondrion; mitotic spindle pole; and spindle microtubule. Orthologous to human RMDN3 (regulator of microtubule dynamics 3); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 1,3,5-trinitro-1,3,5-triazinane; 2,2',5,5'-tetrachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Fam82a2; Fam82c; family with sequence similarity 82, member A2; family with sequence similarity 82, member C; LOC100911313; LOC311328; protein tyrosine phosphatase-interacting protein 51; Ptpip51; regulator of microtubule dynamics protein 3; regulator of microtubule dynamics protein 3-like; RGD1308697; Rmd-3; similar to hypothetical protein FLJ10579

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RMDN3 (regulator of microtubule dynamics 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rmdn3 (regulator of microtubule dynamics 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rmdn3 (regulator of microtubule dynamics 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RMDN3 (regulator of microtubule dynamics 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RMDN3 (regulator of microtubule dynamics 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rmdn3 (regulator of microtubule dynamics 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RMDN3 (regulator of microtubule dynamics 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RMDN3 (regulator of microtubule dynamics 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rmdn3 (regulator of microtubule dynamics 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Rmdn3 (regulator of microtubule dynamics 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RMDN3 (regulator of microtubule dynamics 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rmdn3 (regulator of microtubule dynamics 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rmd-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rmd-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rmd-3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rmd-6	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sup-35	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	rmdn3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	126,579,811 - 126,601,016 (-)	NCBI		GRCr8
mRatBN7.2	3	106,125,961 - 106,146,568 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	106,125,951 - 106,146,586 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	109,799,110 - 109,819,731 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	118,394,646 - 118,415,267 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	116,055,031 - 116,075,652 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	110,943,843 - 110,964,449 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	110,943,826 - 110,964,452 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	117,494,481 - 117,515,087 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	105,651,318 - 105,671,841 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	105,547,751 - 105,568,231 (-)	NCBI
Celera	3	105,039,297 - 105,059,604 (-)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

1,3,5-trinitro-1,3,5-triazinane (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-tribromophenol (ISO)

2-methylcholine (ISO)

3',5'-cyclic AMP (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

caffeine (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

clofibrate (ISO)

doxorubicin (ISO)

efavirenz (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenthion (ISO)

finasteride (EXP)

flufenoxuron (ISO)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

fulvestrant (ISO)

gentamycin (EXP)

ivermectin (ISO)

lead(0) (ISO)

methidathion (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

PCB138 (EXP)

perfluorooctanoic acid (ISO)

phenol red (ISO)

sevoflurane (ISO)

sulindac (EXP)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

cell differentiation (IEA)

intracellular calcium ion homeostasis (ISO,ISS)

Cellular Component

cytoplasm (IBA)

glutamatergic synapse (IDA,IEP)

intercellular bridge (IEA,ISO)

membrane (IEA)

mitochondrial outer membrane (ISO,ISS)

mitochondrion (IBA,ISO)

mitotic spindle pole (IBA,ISO)

nucleus (IEA)

organelle membrane contact site (ISO)

postsynapse (IDA,IEP)

presynapse (IDA,IEP)

spindle microtubule (IBA,ISO)

Molecular Function

microtubule binding (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The VAPB-PTPIP51 endoplasmic reticulum-mitochondria tethering proteins are present in neuronal synapses and regulate synaptic activity.	Gómez-Suaga P, etal., Acta Neuropathol Commun. 2019 Mar 6;7(1):35. doi: 10.1186/s40478-019-0688-4.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:8889548	PMID:17551746	PMID:18614015	PMID:22131369	PMID:25999297

Genomics

Comparative Map Data

Rmdn3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	126,579,811 - 126,601,016 (-)	NCBI		GRCr8
mRatBN7.2	3	106,125,961 - 106,146,568 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	106,125,951 - 106,146,586 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	109,799,110 - 109,819,731 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	118,394,646 - 118,415,267 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	116,055,031 - 116,075,652 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	110,943,843 - 110,964,449 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	110,943,826 - 110,964,452 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	117,494,481 - 117,515,087 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	105,651,318 - 105,671,841 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	105,547,751 - 105,568,231 (-)	NCBI
Celera	3	105,039,297 - 105,059,604 (-)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

RMDN3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	40,735,887 - 40,755,254 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	40,735,884 - 40,755,851 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	41,028,085 - 41,047,452 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	38,815,378 - 38,834,750 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	17,795,976 - 17,815,353 (-)	NCBI		Celera
Cytogenetic Map	15	q15.1	NCBI
HuRef	15	17,876,217 - 17,895,600 (-)	NCBI		HuRef
CHM1_1	15	41,148,086 - 41,167,485 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	38,541,582 - 38,561,277 (-)	NCBI		T2T-CHM13v2.0

Rmdn3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	118,967,479 - 118,987,515 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	118,967,482 - 118,987,515 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	119,136,998 - 119,157,034 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	119,137,001 - 119,157,034 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	118,962,734 - 118,982,770 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	118,828,442 - 118,848,396 (-)	NCBI		MGSCv36	mm8
Celera	2	120,287,522 - 120,307,997 (-)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI
cM Map	2	59.94	NCBI

Rmdn3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	7,591,049 - 7,610,147 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	7,591,049 - 7,610,164 (-)	NCBI	ChiLan1.0	ChiLan1.0

RMDN3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	29,976,840 - 29,996,369 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	34,128,288 - 34,147,804 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	19,676,789 - 19,696,297 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	37,928,987 - 37,948,407 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	37,929,628 - 37,947,856 (-)	Ensembl	panpan1.1		panPan2

RMDN3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	7,878,525 - 7,895,457 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	7,851,605 - 7,896,873 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	7,932,525 - 7,949,439 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	8,005,436 - 8,022,398 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	7,996,329 - 8,022,313 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	7,928,954 - 7,945,875 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	8,035,981 - 8,053,148 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	8,165,022 - 8,181,946 (-)	NCBI		UU_Cfam_GSD_1.0

Rmdn3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	86,291,900 - 86,310,485 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	4,139,583 - 4,158,491 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	4,139,963 - 4,158,519 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RMDN3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	130,574,237 - 130,615,722 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	130,574,283 - 130,591,580 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	145,732,695 - 145,749,962 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RMDN3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	42,243,832 - 42,282,811 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	42,256,613 - 42,278,771 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	98,699,200 - 98,737,589 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rmdn3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624804	7,983,449 - 8,005,842 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624804	7,983,452 - 8,005,864 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rmdn3
62 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	275
Count of miRNA genes:	179
Interacting mature miRNAs:	207
Transcripts:	ENSRNOT00000016356
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat

Markers in Region

RH130688

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	106,126,178 - 106,126,378 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	112,605,308 - 112,605,507	NCBI	Rnor6.0
Rnor_6.0	3	110,944,061 - 110,944,260	NCBI	Rnor6.0
Rnor_5.0	3	119,149,988 - 119,150,187	UniSTS	Rnor5.0
Rnor_5.0	3	117,494,699 - 117,494,898	UniSTS	Rnor5.0
RGSC_v3.4	3	105,651,536 - 105,651,735	UniSTS	RGSC3.4
Celera	3	105,039,515 - 105,039,714	UniSTS
RH 3.4 Map	3	913.1	UniSTS
Cytogenetic Map	3	q35	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	28	57	41	19	41			74	35	38	11
Low		15					8	11			3		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010064616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC082081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ210660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DN931790	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000016356 ⟹ ENSRNOP00000016356

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	106,125,962 - 106,146,586 (-)	Ensembl
Rnor_6.0 Ensembl	3	110,943,826 - 110,964,452 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000071591 ⟹ ENSRNOP00000065235

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	106,125,951 - 106,146,569 (-)	Ensembl
Rnor_6.0 Ensembl	3	112,605,768 - 112,614,503 (-)	Ensembl

RefSeq Acc Id:

NM_001014046 ⟹ NP_001014068

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	126,579,811 - 126,600,418 (-)	NCBI
mRatBN7.2	3	106,125,961 - 106,146,568 (-)	NCBI
Rnor_6.0	3	110,943,843 - 110,964,449 (-)	NCBI
Rnor_5.0	3	117,494,481 - 117,515,087 (-)	NCBI
RGSC_v3.4	3	105,651,318 - 105,671,841 (-)	RGD
Celera	3	105,039,297 - 105,059,604 (-)	RGD

Sequence:

show sequence

CTGGTGACGCGGATTAAGGACGTCAAGATCATTGACAGCGTGAATCCGTGGTGGCTGCTGCTGC
CATGGTGGCTGGCGGCTGGGTACACTATGTCTAGACTGGGGGCCCTGGGCGGCTCCCGCGCCGG
GTTGGGACTGTTACTTGGTACTGCCGCCGGCCTGGGATTCCTGTGTGTCCTCTACAGTCAACGA
TGGAAACGGACCCAACGCCATGGCCGGAGCCAGAGTCTGCCCAACTCCCTGGACTATGCGCAGA
CTTCAGAGCGTGGACGCCAGGTGACACAGTTGCGGGCTATCCCAGGTGAAGCTGGAGATGCTGC
CATGCTGTCCAGCCTCCCACAAGAAGGACAGGAGAAGGTGCTGGACCGCCTGGACTTTGTGCTG
ACCAGTCTTATGGCACTGCGACGGGAGGTAGAGGAGCTTCAGAGAAGCCTGCAAGGCCTGGCTG
GGGAGATTGTCGGGGAGGTTCGATCTCATATGGAGGAGAACCAGAGAGTGGCTCGGCGGCGCAG
GTTCCCTTTTGCCAGGGAGAGGAGTGACTCCACTGGCTCCAGCTCCGTGTATTTCACCGCCTCC
TCAGGGGCTACACTCACAGATGCGGAGAGTGAAGGAGGTTATACGACAGCCAATGCAGAATCTG
ACTATGAGCGGGACTCTGACAAGGAGAGTGAGGATGCTGAAGATGAAGTAAGCTGTGAGACCGT
GAAGATGGGGAGGAAGGATTCTCTGGACCTTGATATGGAGGTAGCTTCAAGTCCCGCGTCTGCT
GCCTTGGAGGATGATGACTCCTCAGGTCTTGAGGATGTGCAGTTGCTCCTGCAGCAGGCGGATG
AGCTGCACCAGGGCAGTGAGCAGAACAAGCAGGAAGGTTTCCAGCTGCTGCTCAACAATAAGCT
GGCGTATGGGAGCCGACAAGACTTTCTGTGGCGCCTGGCCCGGGCCTACAGTGACATGACTGAG
CTTACTGAGGAGGAGAGCGAGAAGAAGTCATATGCCCTAAATGGAAAAGAAGAAGCAGAGGCTG
CTCTGAAGAAAGGAGATGAGAGTGCTGCAAGCCACCTGTGGTATGCAGTGCTTTGTGGTCAGCT
GGCTGAGCATGAGGGCATCTCGAAGCGTATCCAGAGTGGCTTTAGCTTCAAGGAACATGTGGAC
AAAGCCATTGAACTTCAGCCAGAAGACCCCAGGGGTCACTTTCTTCTTGGCAGGTGGTGCTACC
AGGTTTCTCATTTGAGCTGGTTGGAGAAAAAAACAGCTACAGCCTTGTTTGAAAGCCCCCTTAG
TGCCACTGTGCAGGATGCCCTGCAGAGCTTCCTCAAGGCTGAGGAGCTTCAGCCAGGGTTTTCA
AAAGCTGGACGGGTATATATTTCTAAGTGCTATAGAGAATTAGGAAAAAACTCTGAAGCTAGAA
AGTGGCTGAATTTGGCTCAGGAGCTGCCAAACATCACTAATGAGGATTCAGCTTTCCAAAAAGA
CCTGGAAGAACTGGAAGTAATTTTAGGAAAATAATCACATTTCAATTACTGGGGGCCACTACTT
AATGCGGAAGAGAAAATCAAGTTGCTTTTCCTCCTGTGACTCACTGAGTTCACAAGCAAGATGT
CTTGGCCCCTGGAGATGTGACTGTACCACCATCATCCCTCAGTTTTTCATGTTATCACTAATCT
ACCACAATTTAAATTGGGGAATGTACTTGCAGCTAAGGTTTCTGCTTTCTTCCTCTTAAGTGAA
TTCTTGAAAAATCAAGACAGTATAGCCATAGGGTTTAGTGTGGACACAGCCCAGAAGGCCAAGA
GCTGAGAACGAAGCAGCAGAACTGTCTTCCAGCTGCCAGTGAGGTAGATGAACTTCAAAGAGCC
ACGGCAACAAAGCATAGGACTTGTAATCTTTTTTTGCTAATATTCAACACGTATTTATTGTCCT
TTAATGTCATACCTTACCTATGAGGAAAGAAGGAGCCAGCACAGCCCAGGTACTGCTCTCTTAC
CACCCATCATGGAGACTCTACCTATATTCCTGGGCTGAGGGCTGGACCACGGGACTTCCAGAGT
TCTGGCAGCTTTTGGGATGACAGCACTGGCAAAGGGTCTATAAATATATTTTGAAAGTGATCTA
TCTGAAGAGGTACCTGGAATATTTTTTGGTACAAATTAGAAATAAACTAAATTTGATTAGAAGG
TAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XR_010064616

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	126,581,675 - 126,601,016 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014068	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH82081	(Get FASTA)	NCBI Sequence Viewer
	EDL79892	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016356
	ENSRNOP00000016356.5
	ENSRNOP00000065235.3
	ENSRNOP00055003257
	ENSRNOP00060036859
	ENSRNOP00065032260
GenBank Protein	Q66H15	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014068 ⟸ NM_001014046

- UniProtKB:

Q66H15 (UniProtKB/Swiss-Prot), A6HPE1 (UniProtKB/TrEMBL), M0R718 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSRLGALGGSRAGLGLLLGTAAGLGFLCVLYSQRWKRTQRHGRSQSLPNSLDYAQTSERGRQVT
QLRAIPGEAGDAAMLSSLPQEGQEKVLDRLDFVLTSLMALRREVEELQRSLQGLAGEIVGEVRS
HMEENQRVARRRRFPFARERSDSTGSSSVYFTASSGATLTDAESEGGYTTANAESDYERDSDKE
SEDAEDEVSCETVKMGRKDSLDLDMEVASSPASAALEDDDSSGLEDVQLLLQQADELHQGSEQN
KQEGFQLLLNNKLAYGSRQDFLWRLARAYSDMTELTEEESEKKSYALNGKEEAEAALKKGDESA
ASHLWYAVLCGQLAEHEGISKRIQSGFSFKEHVDKAIELQPEDPRGHFLLGRWCYQVSHLSWLE
KKTATALFESPLSATVQDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARKWLNLAQEL
PNITNEDSAFQKDLEELEVILGK

hide sequence

RefSeq Acc Id:

ENSRNOP00000016356 ⟸ ENSRNOT00000016356

RefSeq Acc Id:

ENSRNOP00000065235 ⟸ ENSRNOT00000071591

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R718-F1-model_v2	AlphaFold	M0R718	1-299	view protein structure
AF-Q66H15-F1-model_v2	AlphaFold	Q66H15	1-471	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692320

Promoter ID:

EPDNEW_R2843

Type:

multiple initiation site

Name:

Rmdn3_1

Description:

regulator of microtubule dynamics 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	110,964,422 - 110,964,482	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308697	AgrOrtholog
BioCyc Gene	G2FUF-48218	BioCyc
Ensembl Genes	ENSRNOG00000011690	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00000049007	Ensembl
	ENSRNOG00055002806	UniProtKB/Swiss-Prot
	ENSRNOG00060025688	UniProtKB/Swiss-Prot
	ENSRNOG00065023211	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016356	ENTREZGENE
	ENSRNOT00000016356.7	UniProtKB/Swiss-Prot
	ENSRNOT00000071591.3	UniProtKB/TrEMBL
	ENSRNOT00055004397	UniProtKB/Swiss-Prot
	ENSRNOT00060044486	UniProtKB/Swiss-Prot
	ENSRNOT00065039670	UniProtKB/Swiss-Prot
Gene3D-CATH	1.25.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7133344	IMAGE-MGC_LOAD
InterPro	RMD1-3_a_helical_rpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TPR-like_helical_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:311328	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:95250	IMAGE-MGC_LOAD
NCBI Gene	311328	ENTREZGENE
PANTHER	REGULATOR OF MICROTUBULE DYNAMICS PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	REGULATOR OF MICROTUBULE DYNAMICS PROTEIN 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RMD1-3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rmdn3	PhenoGen
RatGTEx	ENSRNOG00000011690	RatGTEx
	ENSRNOG00000049007	RatGTEx
	ENSRNOG00055002806	RatGTEx
	ENSRNOG00060025688	RatGTEx
	ENSRNOG00065023211	RatGTEx
Superfamily-SCOP	SSF48452	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6HPE1	ENTREZGENE, UniProtKB/TrEMBL
	M0R718	ENTREZGENE, UniProtKB/TrEMBL
	Q66H15	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Rmdn3	regulator of microtubule dynamics 3	LOC100911313	regulator of microtubule dynamics protein 3-like	Data merged from RGD:6493329	737654	PROVISIONAL
2013-01-17	Rmdn3	regulator of microtubule dynamics 3	Fam82a2	family with sequence similarity 82, member A2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100911313	regulator of microtubule dynamics protein 3-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-10-17	Fam82a2	family with sequence similarity 82, member A2	Fam82c	family with sequence similarity 82, member C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Fam82c	family with sequence similarity 82, member C	RGD1308697	similar to hypothetical protein FLJ10579	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1308697	similar to hypothetical protein FLJ10579	RGD1308697_predicted	similar to hypothetical protein FLJ10579 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1308697_predicted	similar to hypothetical protein FLJ10579 (predicted)	LOC311328_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC311328_predicted	similar to hypothetical protein FLJ10579 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar