Il36a (interleukin 36, alpha) - Rat Genome Database

Name: Il36a
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Il36a (interleukin 36, alpha) Rattus norvegicus

Analyze

Symbol:

Il36a

Name:

interleukin 36, alpha

RGD ID:

1306869

Description:

Predicted to enable cytokine activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; cytokine-mediated signaling pathway; and inflammatory response to antigenic stimulus. Predicted to act upstream of or within positive regulation of interleukin-6 production and signal transduction. Predicted to be active in extracellular space. Orthologous to human IL36A (interleukin 36 alpha); INTERACTS WITH bisphenol A; 4-hydroxynon-2-enal (ortholog); aflatoxin B1 (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Il1f6; interleukin 1 family, member 6; interleukin-1 family member 6; interleukin-36 alpha; LOC296541

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IL36A (interleukin 36 alpha)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Il36a (interleukin 36A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IL36A (interleukin 36 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Il36a (interleukin 36 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IL36A (interleukin 36 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IL36G (interleukin 36 gamma)	HGNC	OrthoDB
Homo sapiens (human):	KIAA1191 (KIAA1191)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	IL36A (interleukin 36 alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Il36a (interleukin 36A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	27,395,146 - 27,399,695 (+)	NCBI		GRCr8
mRatBN7.2	3	6,996,851 - 7,001,400 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	6,996,851 - 7,001,400 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	10,091,850 - 10,096,462 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	18,678,075 - 18,682,687 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	16,867,882 - 16,872,494 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	1,330,790 - 1,335,811 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	1,331,226 - 1,335,775 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	1,323,993 - 1,328,542 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	2,482,480 - 2,487,029 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	2,473,610 - 2,485,996 (+)	NCBI
Celera	3	1,834,196 - 1,838,742 (+)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

endometriosis (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

4-hydroxynon-2-enal (ISO)

aflatoxin B1 (ISO)

aldrin (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzalkonium chloride (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

chloroethene (ISO)

cisplatin (ISO)

diarsenic trioxide (ISO)

ferulic acid (ISO)

imiquimod (ISO)

lipopolysaccharide (ISO)

neoechinulin A (ISO)

paraquat (ISO)

pirinixic acid (ISO)

progesterone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

sterigmatocystin (ISO)

testosterone (ISO)

titanium dioxide (ISO)

TMC-120A (ISO)

Tributyltin oxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to lipopolysaccharide (IBA)

cytokine-mediated signaling pathway (IBA)

inflammatory response to antigenic stimulus (IBA)

positive regulation of cytokine production (ISO)

positive regulation of gene expression (IBA)

positive regulation of interleukin-6 production (ISO)

Cellular Component

extracellular space (IBA,ISO)

Molecular Function

cytokine activity (IBA,ISO)

interleukin-1 receptor binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:19717513	PMID:21860022

Genomics

Comparative Map Data

Il36a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	27,395,146 - 27,399,695 (+)	NCBI		GRCr8
mRatBN7.2	3	6,996,851 - 7,001,400 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	6,996,851 - 7,001,400 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	10,091,850 - 10,096,462 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	18,678,075 - 18,682,687 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	16,867,882 - 16,872,494 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	1,330,790 - 1,335,811 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	1,331,226 - 1,335,775 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	1,323,993 - 1,328,542 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	2,482,480 - 2,487,029 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	2,473,610 - 2,485,996 (+)	NCBI
Celera	3	1,834,196 - 1,838,742 (+)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

IL36A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	113,005,459 - 113,011,072 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	113,005,459 - 113,008,044 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	113,763,036 - 113,765,621 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	113,479,920 - 113,482,092 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	113,479,679 - 113,481,852	NCBI
Celera	2	107,148,610 - 107,150,782 (+)	NCBI		Celera
Cytogenetic Map	2	q14.1	NCBI
HuRef	2	106,218,002 - 106,220,174 (+)	NCBI		HuRef
CHM1_1	2	113,767,604 - 113,769,776 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	113,431,988 - 113,437,599 (+)	NCBI		T2T-CHM13v2.0

Il36a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	24,105,429 - 24,115,713 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	24,105,430 - 24,115,714 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	24,215,417 - 24,225,701 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	24,215,418 - 24,225,702 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	24,070,937 - 24,081,221 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	24,037,426 - 24,047,710 (+)	NCBI		MGSCv36	mm8
Celera	2	23,934,862 - 23,945,148 (+)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	16.26	NCBI

IL36A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	15,143,627 - 15,157,101 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	15,146,393 - 15,151,862 (-)	NCBI		NHGRI_mPanPan1

Il36a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	82,474,970 - 82,476,974 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936783	1,369,537 - 1,371,458 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936783	1,369,454 - 1,371,458 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL36A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	16,017,847 - 16,030,680 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	16,028,002 - 16,030,097 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666080	3,651,138 - 3,653,829 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Il36a
23 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	166
Count of miRNA genes:	117
Interacting mature miRNAs:	128
Transcripts:	ENSRNOT00000007540
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	diastolic blood pressure (CMO:0000005)	3	1	33278763	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1358185	Ept6	Estrogen-induced pituitary tumorigenesis QTL 6	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6537645	10778823	Rat
2292615	Ept17	Estrogen-induced pituitary tumorigenesis QTL 17	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6537645	10778823	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	nervous system	renal system	reproductive system	respiratory system
High
Medium
Low		4	4		4			3	4
Below cutoff	1	7	5	10	5	1	2	6	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008761581	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000007540 ⟹ ENSRNOP00000007540

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	6,996,851 - 7,001,400 (+)	Ensembl
Rnor_6.0 Ensembl	3	1,331,226 - 1,335,775 (+)	Ensembl

RefSeq Acc Id:

NM_001106554 ⟹ NP_001100024

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	27,395,146 - 27,399,695 (+)	NCBI
mRatBN7.2	3	6,996,851 - 7,001,400 (+)	NCBI
Rnor_6.0	3	1,331,226 - 1,335,775 (+)	NCBI
Rnor_5.0	3	1,323,993 - 1,328,542 (+)	NCBI
RGSC_v3.4	3	2,482,480 - 2,487,029 (+)	RGD
Celera	3	1,834,196 - 1,838,742 (+)	RGD

Sequence:

show sequence

TAATCTCCTCCCTTCATGTTTTGGATAAAAGGCCTGGACCCTAGCAGAGCTTGTCAGAGAAGCT
GAGCACAGTAGTGGCTGTAGTTCTGTAGTGTGCAGATACATTCCTCTGCAATCAGGATCAGTCT
GCAGATTGGCAGTTCAGAAACAACATCACCATAATGAATAAGGATAAAGAACTAAGTGCAGCAA
CACCTTGGTTTAGACATATTCAGGATCTTAGTAGTCGTGTGTGGGTCCTTCAAGACAATATTCT
TACTGCAGTCCCAAGGAAAGAGCAAACGGTTCCAGTCACTATCACCTTACTCCCATGCCAATAT
CTGGACACTCTTGAGAAGAACAAAGGGGATCCCATGTACCTGGGAGTGAAGAAACCTCAAAGTT
GTCTGTCCTGCACAAAGAATGGGGAGCAGCCTGTACTACAACTTCGGGAAGGGAACATACTGGA
TATGTACCACCAGAAGGAACGTGTAAAAGCCTCTCTCTTCTATCACAAGAAGAGTGGTACAACC
TCTACATTCGAGTCTGCAGCCTTCCCTGGTTGGTTCATTGCTGTCTGCTCCAAAGGGAGCTGCC
CACTCGTTTTGACCCAAGAACTTGGGAAAACCTTCATCACTGATTTTGAGATGACTGTAGTACA
TTAAGATTGCTCTGCAGCACTCTCTGAAGATCTCTCGGATTCTAACAAGCAACCAAACACACCC
CCAACAAAATACAAGACTGAAAAGAAAGCTGAGCCCTCCCTGGGCTTTTTTCCCTTGGCAGGTG
GATCAGATGCAGAACTTCTTACCATGTTTTCATCCAAAGCATTTACTGATGGTTTTTACAAGAA
GAAAACGTTTTTAATTAAAATCATTTATCTCACTTGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100024	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL93670	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007540
	ENSRNOP00000007540.4

RefSeq Acc Id:	NP_001100024 ⟸ NM_001106554
- UniProtKB:	D4A1I2 (UniProtKB/TrEMBL), A6JSX7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MNKDKELSAATPWFRHIQDLSSRVWVLQDNILTAVPRKEQTVPVTITLLPCQYLDTLEKNKGDP MYLGVKKPQSCLSCTKNGEQPVLQLREGNILDMYHQKERVKASLFYHKKSGTTSTFESAAFPGW FIAVCSKGSCPLVLTQELGKTFITDFEMTVVH hide sequence

RefSeq Acc Id:

ENSRNOP00000007540 ⟸ ENSRNOT00000007540

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A1I2-F1-model_v2	AlphaFold	D4A1I2	1-160	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306869	AgrOrtholog
BioCyc Gene	G2FUF-50512	BioCyc
Ensembl Genes	ENSRNOG00000005722	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000007540	ENTREZGENE
	ENSRNOT00000007540.6	UniProtKB/TrEMBL
Gene3D-CATH	2.80.10.50	UniProtKB/TrEMBL
InterPro	Cytokine_IL1-like	UniProtKB/TrEMBL
	IL_rcpt_IL1RA	UniProtKB/TrEMBL
	Interleukin_1	UniProtKB/TrEMBL
KEGG Report	rno:296541	UniProtKB/TrEMBL
NCBI Gene	296541	ENTREZGENE
PANTHER	PTHR10078	UniProtKB/TrEMBL
	PTHR10078:SF25	UniProtKB/TrEMBL
Pfam	IL1	UniProtKB/TrEMBL
PhenoGen	Il36a	PhenoGen
PRINTS	INTERLEUKIN1	UniProtKB/TrEMBL
	INTRLEUKIN1X	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005722	RatGTEx
SMART	IL1	UniProtKB/TrEMBL
Superfamily-SCOP	Cytok_IL1_like	UniProtKB/TrEMBL
UniProt	A6JSX7	ENTREZGENE, UniProtKB/TrEMBL
	D4A1I2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-05-03	Il36a	interleukin 36, alpha	Il1f6	interleukin 1 family, member 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Il1f6	interleukin 1 family, member 6	Il1f6_predicted	interleukin 1 family, member 6 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Il1f6_predicted	interleukin 1 family, member 6 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar