Wnt8a (Wnt family member 8A) - Rat Genome Database

Name: Wnt8a
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Wnt8a (Wnt family member 8A) Rattus norvegicus

Analyze

Symbol:

Wnt8a

Name:

Wnt family member 8A

RGD ID:

1306312

Description:

Predicted to enable cytokine activity and frizzled binding activity. Predicted to be involved in several processes, including canonical Wnt signaling pathway; neuron differentiation; and secondary palate development. Predicted to act upstream of or within several processes, including axis specification; endoderm development; and regulation of protein localization. Predicted to be active in extracellular space. Orthologous to human WNT8A (Wnt family member 8A); PARTICIPATES IN Wnt signaling pathway; Wnt signaling, canonical pathway; basal cell carcinoma pathway; INTERACTS WITH atrazine; diazinon; nickel atom.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC291678; wingless-related MMTV integration site 8A; wingless-type MMTV integration site family, member 8A

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WNT8A (Wnt family member 8A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Wnt8a (wingless-type MMTV integration site family, member 8A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wnt8a (Wnt family member 8A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WNT8A (Wnt family member 8A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WNT8A (Wnt family member 8A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wnt8a (Wnt family member 8A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WNT8A (Wnt family member 8A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WNT8A (Wnt family member 8A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wnt8a (Wnt family member 8A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RNASE4 (ribonuclease A family member 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	WNT8A (Wnt family member 8A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Wnt8a (wingless-type MMTV integration site family, member 8A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wnt8a (wingless-type MMTV integration site family, member 8a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	wntD	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	wnt8a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	26,411,833 - 26,417,426 (+)	NCBI		GRCr8
mRatBN7.2	18	26,137,690 - 26,143,283 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	26,137,690 - 26,143,283 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	26,265,080 - 26,270,673 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	27,028,812 - 27,034,426 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	26,363,713 - 26,369,327 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	27,331,236 - 27,336,829 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	27,331,236 - 27,336,829 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	27,044,608 - 27,050,201 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	27,007,156 - 27,012,749 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	27,029,469 - 27,038,824 (+)	NCBI
Celera	18	25,876,225 - 25,881,818 (+)	NCBI		Celera
Cytogenetic Map	18	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

atrial fibrillation (ISO)

autosomal dominant intellectual developmental disorder 31 (ISO)

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

hypospadias (ISO)

Neurodevelopmental Disorders (ISO)

STING-associated vasculopathy with onset in infancy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

carbamazepine (ISO)

diazinon (EXP)

dorsomorphin (ISO)

entinostat (ISO)

genistein (ISO)

mono(2-ethylhexyl) phthalate (ISO)

Monobutylphthalate (ISO)

nickel atom (EXP)

panobinostat (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

SB 431542 (ISO)

thalidomide (ISO)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

canonical Wnt signaling pathway (IBA,ISO)

cell fate commitment (IBA)

cell morphogenesis (ISO)

endoderm development (ISO)

establishment of animal organ orientation (ISO)

neuron differentiation (IBA)

polarity specification of anterior/posterior axis (ISO)

polarity specification of proximal/distal axis (ISO)

regionalization (ISO)

regulation of protein localization (ISO)

secondary palate development (ISO)

Cellular Component

extracellular space (IBA)

Molecular Function

cytokine activity (IBA)

frizzled binding (IBA)

protein binding (ISO)

receptor ligand activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA)

Wnt signaling pathway (IEA,ISO)

Wnt signaling, canonical pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA
9.	Alternative wnt signaling is initiated by distinct receptors.	van Amerongen R, etal., Sci Signal. 2008 Sep 2;1(35):re9.

Additional References at PubMed

PMID:16256739	PMID:18413325	PMID:20559569	PMID:28733458

Genomics

Comparative Map Data

Wnt8a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	26,411,833 - 26,417,426 (+)	NCBI		GRCr8
mRatBN7.2	18	26,137,690 - 26,143,283 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	26,137,690 - 26,143,283 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	26,265,080 - 26,270,673 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	27,028,812 - 27,034,426 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	26,363,713 - 26,369,327 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	27,331,236 - 27,336,829 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	27,331,236 - 27,336,829 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	27,044,608 - 27,050,201 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	27,007,156 - 27,012,749 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	27,029,469 - 27,038,824 (+)	NCBI
Celera	18	25,876,225 - 25,881,818 (+)	NCBI		Celera
Cytogenetic Map	18	p12	NCBI

WNT8A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	138,077,367 - 138,092,365 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	138,083,990 - 138,092,365 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	137,419,722 - 137,428,054 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	137,447,673 - 137,455,098 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	137,447,577 - 137,455,953	NCBI
Celera	5	133,541,722 - 133,549,145 (+)	NCBI		Celera
Cytogenetic Map	5	q31.2	NCBI
HuRef	5	132,610,733 - 132,618,179 (+)	NCBI		HuRef
CHM1_1	5	136,852,364 - 136,859,793 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	138,603,716 - 138,618,708 (+)	NCBI		T2T-CHM13v2.0

Wnt8a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	34,675,380 - 34,681,114 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	34,675,366 - 34,681,326 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	34,542,327 - 34,548,061 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	34,542,313 - 34,548,273 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	34,701,982 - 34,707,715 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	34,667,114 - 34,673,074 (+)	NCBI		MGSCv36	mm8
Celera	18	34,995,948 - 35,001,675 (+)	NCBI		Celera
Cytogenetic Map	18	B1	NCBI
cM Map	18	18.69	NCBI

Wnt8a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	2,332,636 - 2,338,085 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955418	2,332,636 - 2,338,099 (-)	NCBI	ChiLan1.0	ChiLan1.0

WNT8A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	133,354,550 - 133,367,296 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	131,494,107 - 131,506,856 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	133,419,324 - 133,471,094 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	139,598,229 - 139,605,926 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	139,598,229 - 139,605,926 (+)	Ensembl	panpan1.1		panPan2

WNT8A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	25,707,058 - 25,752,724 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	25,744,780 - 25,749,748 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	24,470,773 - 24,519,397 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	26,556,926 - 26,605,507 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	26,558,406 - 26,603,592 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	25,264,436 - 25,313,063 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	25,088,231 - 25,136,559 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	25,751,347 - 25,800,034 (+)	NCBI		UU_Cfam_GSD_1.0

Wnt8a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	154,332,315 - 154,337,724 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936531	7,273,882 - 7,278,959 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936531	7,273,681 - 7,279,394 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WNT8A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	140,103,830 - 140,109,862 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	140,103,322 - 140,113,682 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	145,777,794 - 145,784,671 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WNT8A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	40,750,907 - 40,759,421 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	40,751,780 - 40,758,790 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	37,130,575 - 37,139,750 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wnt8a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624743	30,890,359 - 30,895,682 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624743	30,852,463 - 30,896,443 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wnt8a
22 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	145
Count of miRNA genes:	120
Interacting mature miRNAs:	135
Transcripts:	ENSRNOT00000064574
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
12904690	Cm129	Cardiac mass QTL 129		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	11944273	26548295	Rat
12904689	Cm128	Cardiac mass QTL 128		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	11944273	26548295	Rat
12904693	Am20	Aortic mass QTL 20		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	11944273	26548295	Rat
12904695	Kidm73	Kidney mass QTL 73		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	11944273	26548295	Rat
12904691	Cm130	Cardiac mass QTL 130		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	11944273	26548295	Rat
12904680	Bw189	Body weight QTL 189		0.019	body mass (VT:0001259)	body weight (CMO:0000012)	18	11944273	26548295	Rat
2301410	Bp317	Blood pressure QTL 317		0.004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944273	26548295	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	18234564	31359530	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	18234564	31359530	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat

Markers in Region

Wnt8a

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	26,142,591 - 26,143,134 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	27,336,138 - 27,336,680	NCBI	Rnor6.0
Rnor_5.0	18	27,049,510 - 27,050,052	UniSTS	Rnor5.0
RGSC_v3.4	18	27,012,058 - 27,012,600	UniSTS	RGSC3.4
Celera	18	25,881,127 - 25,881,669	UniSTS
Cytogenetic Map	18	p12	UniSTS

Wnt8a

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	26,142,410 - 26,142,611 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	27,335,957 - 27,336,157	NCBI	Rnor6.0
Rnor_5.0	18	27,049,329 - 27,049,529	UniSTS	Rnor5.0
RGSC_v3.4	18	27,011,877 - 27,012,077	UniSTS	RGSC3.4
Celera	18	25,880,946 - 25,881,146	UniSTS
Cytogenetic Map	18	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	nervous system	renal system	reproductive system	respiratory system
High
Medium
Low				1				1
Below cutoff	2	1	1		1	17	1	17	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000064574 ⟹ ENSRNOP00000059050

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	26,137,690 - 26,143,283 (+)	Ensembl
Rnor_6.0 Ensembl	18	27,331,236 - 27,336,829 (+)	Ensembl

RefSeq Acc Id:

NM_001106155 ⟹ NP_001099625

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	26,411,833 - 26,417,426 (+)	NCBI
mRatBN7.2	18	26,137,690 - 26,143,283 (+)	NCBI
Rnor_6.0	18	27,331,236 - 27,336,829 (+)	NCBI
Rnor_5.0	18	27,044,608 - 27,050,201 (+)	NCBI
RGSC_v3.4	18	27,007,156 - 27,012,749 (+)	RGD
Celera	18	25,876,225 - 25,881,818 (+)	RGD

Sequence:

show sequence

GTTCTGCGGGCTCCTTACTTCTCTGCACTTGGTCCCCCGGAATGGTCAGGACCATGGGACACTT
TTTCATGCTGTGGGTGGCTGCGGGCATGTGTTATACCGCTTTCGGTGCTTCTGCCTGGTCAGTG
AACAATTTCCTGATAACAGGTCCCAAGGCCTATGTGACCTACACCGCCAGCGTGGCCTTGGGCG
CTCAGATGGGCATGGAAGAGTGTAAGTTCCAGTTTGCCTGGGAGCGGTGGAACTGTCCTGAGCA
CGCTTTCCAGTTTTCAACCCACACCAGGCCGAGAGGTGCCACGAGAGAGACATCCTTCATCCAT
GCCATCCGCTCTGCTGCAGTCATGTACGCTGTCACCAAGAACTGTAGCATGGGCGACTTGGAAA
CCTGTGGCTGTGATGAGTCAAATAATGGGAAAGCAGGTGGCCATGGCTGGATCTGGGGAGGCTG
CAGCGACAATGTGGAATTCGGGGAAAAGATCTCCAGACTCTTTGTGGACAGTTTGGAGAAAGGA
AAGGATGCCAGAGCCCTGATGAATCTTCACAACAACAGGGCTGGCAGGCTGGCAGTGAGGGCCT
CTATGAAAAGAACCTGCAAGTGTCATGGCATCTCAGGAAGCTGCAGCATCCAGACGTGTTGGCT
GCAGCTGGCTGACTTCCGGCAGATGGGAAATTACCTAAAGGCCAAGTATGACCGCGCGCTGAAA
ATTGAGACGGATAAGCGCCAGCTCAGGGCTGGCAACAGAGCTGAAGGCCGCTGGGCTCCCATCG
AGGCCTTCCTTCCCAGCGCAGAGGCTGAGCTGATCTTCTTAGAGGGGTCTCCTGACTACTGCAA
CCGCAATGCCAGCCTGGGCATCTACGGCACAGAGGGGCGGGAGTGCCTGCAGAACGCCCGCAGT
GCTTCCCGGTGGGAGCAGCGCAGCTGTGGGCGCCTGTGCACCGAGTGTGGGCTGCAGGTGGAGG
AGAGGCGAACAGAGGCCGTGAGCAGCTGTGACTGCAACTTTCAGTGGTGTTGCACGGTCAAGTG
TGGCCAGTGCAGGCGTGTGGTGAACAGGTACTACTGCACACGCCCTGCAGGTAGTGCGGGGCCC
CGGGGCACCACCACAAAGTCACTTGTTGCTTAGTTGCACGACAGTGGAGGTGGGGACTGAACTT
CTGGTGTAGGGGGACACAGACTGGAAAACTGGGACCTCACAGGGTTGGCCTGTAGACCTTCCAC
GATAGGTGGGGTAGGTGGATGATGTTACAGCATCTTCTTCGCAAGGCTGAAATCGGAACCTTGT
TCTCCTGGCTTGTGGACCCAGCCTTTACCACACAGTTACTCTTGGACTTGAGGAGCTTGTTAAA
GACGGAGTTTGGTTTGGATGCACATCCAGAGGACCCTCAAACAATTTGTTCCATGAAGCTTCAG
ATACTGTTCCTTCCGCCCAGTTATGCAGCTGGGAATTAGAGGGAAGAGAAGCTAAAGGAAAGGA
ATTCTGGAGGCCAGGAGAGATGGCTTAGTGGTTAAGAGCACTGGGTGGCCTTCCAGAGGACTGG
TTCACTTCGCAGCACCCACTTGGTGGCTGTGGGCCATCCGTACCTCCAGTTCCAGGGGATCCAA
TGTGTCCTTTTGTGGTCTCCGTGACCACCAAGCACAAATGTGTGCAGACAGAACATTTATACAT
ATAAAATAATAAAGTAAAACTTACATTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099625	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL76228	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000059050
	ENSRNOP00000059050.1

RefSeq Acc Id:	NP_001099625 ⟸ NM_001106155
- Peptide Label:	precursor
- UniProtKB:	D4A9D7 (UniProtKB/TrEMBL), A6J2U6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVRTMGHFFMLWVAAGMCYTAFGASAWSVNNFLITGPKAYVTYTASVALGAQMGMEECKFQFAW ERWNCPEHAFQFSTHTRPRGATRETSFIHAIRSAAVMYAVTKNCSMGDLETCGCDESNNGKAGG HGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALMNLHNNRAGRLAVRASMKRTCKCHGISGS CSIQTCWLQLADFRQMGNYLKAKYDRALKIETDKRQLRAGNRAEGRWAPIEAFLPSAEAELIFL EGSPDYCNRNASLGIYGTEGRECLQNARSASRWEQRSCGRLCTECGLQVEERRTEAVSSCDCNF QWCCTVKCGQCRRVVNRYYCTRPAGSAGPRGTTTKSLVA hide sequence

RefSeq Acc Id:

ENSRNOP00000059050 ⟸ ENSRNOT00000064574

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A9D7-F1-model_v2	AlphaFold	D4A9D7	1-359	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306312	AgrOrtholog
BioCyc Gene	G2FUF-7955	BioCyc
Ensembl Genes	ENSRNOG00000020157	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064574	ENTREZGENE
	ENSRNOT00000064574.2	UniProtKB/TrEMBL
Gene3D-CATH	3.30.2460.20	UniProtKB/TrEMBL
InterPro	Wnt8	UniProtKB/TrEMBL
	Wnt_C	UniProtKB/TrEMBL
	Wnt_grthfactor_CS	UniProtKB/TrEMBL
	Wnt_SF	UniProtKB/TrEMBL
KEGG Report	rno:291678	UniProtKB/TrEMBL
NCBI Gene	291678	ENTREZGENE
PANTHER	PTHR12027:SF92	UniProtKB/TrEMBL
	Wnt	UniProtKB/TrEMBL
Pfam	wnt	UniProtKB/TrEMBL
PhenoGen	Wnt8a	PhenoGen
PRINTS	WNT8PROTEIN	UniProtKB/TrEMBL
	WNTPROTEIN	UniProtKB/TrEMBL
PROSITE	WNT1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000020157	RatGTEx
SMART	WNT1	UniProtKB/TrEMBL
UniProt	A6J2U6	ENTREZGENE, UniProtKB/TrEMBL
	D4A9D7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Wnt8a	Wnt family member 8A	Wnt8a	wingless-type MMTV integration site family, member 8A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-14	Wnt8a	wingless-type MMTV integration site family, member 8A	Wnt8a	wingless-related MMTV integration site 8A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Wnt8a	wingless-related MMTV integration site 8A	Wnt8a_predicted	wingless-related MMTV integration site 8A (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Wnt8a_predicted	wingless-related MMTV integration site 8A (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)