Npbwr1 (neuropeptides B and W receptor 1)

Gene: Npbwr1 (neuropeptides B and W receptor 1) Rattus norvegicus

Analyze

Symbol:

Npbwr1

Name:

neuropeptides B and W receptor 1

RGD ID:

1305917

Description:

Predicted to enable G protein-coupled receptor activity and neuropeptide binding activity. Predicted to be involved in neuropeptide signaling pathway. Predicted to act upstream of or within regulation of metabolic process. Predicted to be located in plasma membrane. Predicted to be active in neuron projection. Orthologous to human NPBWR1 (neuropeptides B and W receptor 1); INTERACTS WITH bisphenol A; C60 fullerene; gentamycin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G protein-coupled receptor 7; G-protein coupled receptor 7; Gpr7; LOC297795; Nbpwr1; neuropeptides B/W receptor 1; neuropeptides B/W receptor type 1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NPBWR1 (neuropeptides B and W receptor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Npbwr1 (neuropeptides B/W receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Npbwr1 (neuropeptides B and W receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NPBWR1 (neuropeptides B and W receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NPBWR1 (neuropeptides B and W receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Npbwr1 (neuropeptides B and W receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NPBWR1 (neuropeptides B and W receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NPBWR1 (neuropeptides B and W receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Npbwr1 (neuropeptides B and W receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NPBWR1 (neuropeptides B and W receptor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Npbwr1 (neuropeptides B/W receptor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-16	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	npr-24	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	npbwr1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	18,282,180 - 18,285,622 (+)	NCBI		GRCr8
mRatBN7.2	5	13,495,319 - 13,498,761 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	13,495,426 - 13,496,415 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	15,661,002 - 15,661,991 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	17,305,633 - 17,306,622 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	16,995,703 - 16,996,692 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	13,379,772 - 13,380,761 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	13,379,772 - 13,380,761 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	18,149,038 - 18,150,027 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	13,637,094 - 13,638,083 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	13,637,093 - 13,638,082 (+)	NCBI
Celera	5	12,903,127 - 12,904,116 (+)	NCBI		Celera
Cytogenetic Map	5	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

4,4'-sulfonyldiphenol (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

fulvestrant (ISO)

gentamycin (EXP)

iron dichloride (ISO)

lipopolysaccharide (ISO)

mono(2-ethylhexyl) phthalate (ISO)

quercitrin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (ISO)

neuropeptide signaling pathway (IBA)

regulation of metabolic process (ISO)

Cellular Component

neuron projection (IBA)

plasma membrane (IBA,IEA)

Molecular Function

G protein-coupled receptor activity (IBA)

neuropeptide binding (IBA)

neuropeptide receptor activity (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12401809	PMID:12925742	PMID:16736466	PMID:33105700

Genomics

Comparative Map Data

Npbwr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	18,282,180 - 18,285,622 (+)	NCBI		GRCr8
mRatBN7.2	5	13,495,319 - 13,498,761 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	13,495,426 - 13,496,415 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	15,661,002 - 15,661,991 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	17,305,633 - 17,306,622 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	16,995,703 - 16,996,692 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	13,379,772 - 13,380,761 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	13,379,772 - 13,380,761 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	18,149,038 - 18,150,027 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	13,637,094 - 13,638,083 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	13,637,093 - 13,638,082 (+)	NCBI
Celera	5	12,903,127 - 12,904,116 (+)	NCBI		Celera
Cytogenetic Map	5	q12	NCBI

NPBWR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	52,939,182 - 52,943,734 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	52,939,182 - 52,943,734 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	53,851,742 - 53,856,294 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	54,015,021 - 54,016,007 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	54,015,020 - 54,016,007	NCBI
Celera	8	49,843,313 - 49,844,299 (+)	NCBI		Celera
Cytogenetic Map	8	q11.23	NCBI
HuRef	8	49,319,868 - 49,320,854 (+)	NCBI		HuRef
CHM1_1	8	53,904,190 - 53,905,176 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	53,315,605 - 53,320,157 (+)	NCBI		T2T-CHM13v2.0

Npbwr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	5,983,926 - 5,987,617 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	5,983,926 - 5,987,617 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	5,913,707 - 5,917,398 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	5,913,707 - 5,917,398 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	5,903,788 - 5,907,479 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	5,903,788 - 5,907,479 (-)	NCBI		MGSCv36	mm8
Celera	1	5,903,854 - 5,907,545 (-)	NCBI		Celera
Cytogenetic Map	1	A1	NCBI
cM Map	1	1.89	NCBI

Npbwr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955454	12,453,047 - 12,453,676 (+)	NCBI	ChiLan1.0	ChiLan1.0

NPBWR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	68,574,398 - 68,579,711 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	44,299,388 - 44,301,866 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	49,363,390 - 49,368,499 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	46,745,428 - 46,746,949 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	46,745,428 - 46,746,414 (+)	Ensembl	panpan1.1		panPan2

NPBWR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	4,772,851 - 4,774,412 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	4,773,409 - 4,774,404 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	5,213,096 - 5,214,096 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	4,843,580 - 4,844,580 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	4,843,585 - 4,844,580 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	4,776,129 - 4,777,129 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	4,997,715 - 4,998,715 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	5,078,264 - 5,079,264 (+)	NCBI		UU_Cfam_GSD_1.0

Npbwr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	74,810,294 - 74,849,609 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936590	36,377 - 38,899 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936590	38,185 - 38,899 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NPBWR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	77,539,087 - 77,540,079 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	77,539,000 - 77,540,691 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	84,561,705 - 84,562,872 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NPBWR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	49,049,142 - 49,053,037 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	49,049,238 - 49,050,224 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	92,938,770 - 92,945,140 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Npbwr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	2,574,026 - 2,575,018 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624735	2,573,992 - 2,576,509 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Npbwr1
6 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	45
Interacting mature miRNAs:	45
Transcripts:	ENSRNOT00000010032
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
2312562	Pur18	Proteinuria QTL 18	2.6	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	5	2138965	32656739	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2313085	Bss59	Bone structure and strength QTL 59	2.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	5	3844018	26141981	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	3844018	47869213	Rat
61462	Niddm10	Non-insulin dependent diabetes mellitus QTL 10	3.9	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	5	5112159	47171491	Rat
631827	Alc4	Alcohol consumption QTL 4	3.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	5	8187501	18616199	Rat
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	8948228	53948228	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	12689285	57689285	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	nervous system	renal system	reproductive system	respiratory system
High
Medium
Low	22		9
Below cutoff	33	4	20	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY577901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000010032 ⟹ ENSRNOP00000010032

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	13,495,426 - 13,496,415 (+)	Ensembl
Rnor_6.0 Ensembl	5	13,379,772 - 13,380,761 (+)	Ensembl

RefSeq Acc Id:

NM_001014784 ⟹ NP_001014784

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	18,282,180 - 18,285,622 (+)	NCBI
mRatBN7.2	5	13,495,319 - 13,498,761 (+)	NCBI
Rnor_6.0	5	13,379,772 - 13,380,761 (+)	NCBI
Rnor_5.0	5	18,149,038 - 18,150,027 (+)	NCBI
RGSC_v3.4	5	13,637,094 - 13,638,083 (+)	RGD
Celera	5	12,903,127 - 12,904,116 (+)	RGD

Sequence:

show sequence

ATGCACAACTTGTCGCTCTTCGAGCCTGGCAGGGGCAATGTGTCTTGCGGCGGCCCATTTTTGG
GCTGTCCTAACGAGTCGAACCCAGCGCCTCTGCCACTGCCGCAGCCTCTGGCGGTAGCAGTGCC
TGTGGTCTACGGGGTGATCTGCGCGGTGGGACTGGCGGGCAACTCCGCGGTGCTGTACGTACTG
CTGCGCACGCCGCGCATGAAGACTGTTACCAACGTGTTCATTCTCAACCTGGCTATCGCGGACG
AGCTCTTCACCCTCGTGCTGCCCATCAACATCGCGGATTTCCTGCTGAGGCGCTGGCCCTTCGG
GGAAGTCATGTGCAAGCTCATCGTGGCTGTCGACCAGTACAACACTTTCTCTAGCCTCTACTTC
CTCGCCGTCATGAGCGCAGACCGCTACCTGGTTGTCCTGGCCACAGCCGAGTCGCGCCGGGTGT
CCGGGCGCACTTATGGTGCAGCGCGGGCTGTCAGTCTGGCGGTGTGGGCGCTGGTGACATTGGT
CGTGCTGCCTTTTGCGGTATTCGCCCGGCTGGACGAAGAGCAGGGTCGGCGTCAGTGCGTGCTG
GTCTTCCCGCAGCCTGAGGCCTTCTGGTGGCGCGCCAGCCGTCTGTACACTCTAGTGTTGGGCT
TCGCCATCCCGGTGTCCACCATCTGCGCCCTCTATATCACCCTGTTGTGCCGACTGCGTGCTAT
CCAGCTAGACAGCCACGCCAAGGCCCTGGACCGTGCCAAGAAGCGCGTGACCTTGTTGGTGGTG
GCGATTCTGGCTGTGTGCCTCCTCTGCTGGACACCGTACCACCTGAGCACCATAGTGGCGCTCA
CCACCGACCTCCCGCAAACACCGTTGGTCATCGGCATCTCTTACTTCATCACCAGTCTGAGCTA
TGCCAACAGCTGCCTCAACCCTTTCCTCTATGCCTTCCTGGACGACAGCTTCCGCAGGAGCCTG
CGGCAGCTGGTGTCATGCCGCACAGCCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001014784	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAT72915	(Get FASTA)	NCBI Sequence Viewer
	EDM11578	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010032
	ENSRNOP00000010032.2
	ENSRNOP00055024126
	ENSRNOP00060013744
	ENSRNOP00065024878
GenBank Protein	Q56UD9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014784 ⟸ NM_001014784

- UniProtKB:

Q56UD9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MHNLSLFEPGRGNVSCGGPFLGCPNESNPAPLPLPQPLAVAVPVVYGVICAVGLAGNSAVLYVL
LRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEVMCKLIVAVDQYNTFSSLYF
LAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVVLPFAVFARLDEEQGRRQCVL
VFPQPEAFWWRASRLYTLVLGFAIPVSTICALYITLLCRLRAIQLDSHAKALDRAKKRVTLLVV
AILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFITSLSYANSCLNPFLYAFLDDSFRRSL
RQLVSCRTA

hide sequence

RefSeq Acc Id:

ENSRNOP00000010032 ⟸ ENSRNOT00000010032

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q56UD9-F1-model_v2	AlphaFold	Q56UD9	1-329	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305917	AgrOrtholog
BioCyc Gene	G2FUF-42163	BioCyc
Ensembl Genes	ENSRNOG00000007640	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055017758	UniProtKB/Swiss-Prot
	ENSRNOG00060010464	UniProtKB/Swiss-Prot
	ENSRNOG00065018605	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010032	ENTREZGENE
	ENSRNOT00000010032.3	UniProtKB/Swiss-Prot
	ENSRNOT00055030036	UniProtKB/Swiss-Prot
	ENSRNOT00060017684	UniProtKB/Swiss-Prot
	ENSRNOT00065031231	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Neuropept_B/W_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:297795	UniProtKB/Swiss-Prot
NCBI Gene	297795	ENTREZGENE
PANTHER	NEUROPEPTIDES RECEPTOR	UniProtKB/Swiss-Prot
	PTHR24229:SF47	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Npbwr1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	NRPEPTIDEWR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007640	RatGTEx
	ENSRNOG00055017758	RatGTEx
	ENSRNOG00060010464	RatGTEx
	ENSRNOG00065018605	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	NPBW1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-02-01	Npbwr1	neuropeptides B and W receptor 1	Npbwr1	neuropeptides B/W receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Npbwr1	neuropeptides B/W receptor 1	Nbpwr1	neuropeptides B/W receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Nbpwr1	neuropeptides B/W receptor 1	Gpr7	G protein-coupled receptor 7	Symbol and Name updated	1299863	APPROVED
2005-12-06	Gpr7	G protein-coupled receptor 7	Gpr7_predicted	G protein-coupled receptor 7 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Gpr7_predicted	G protein-coupled receptor 7 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar