Tubb6 (tubulin, beta 6 class V) - Rat Genome Database

Name: Tubb6
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Tubb6 (tubulin, beta 6 class V) Rattus norvegicus

Analyze

Symbol:

Tubb6

Name:

tubulin, beta 6 class V

RGD ID:

1305887

Description:

Predicted to enable GTP binding activity. Predicted to be a structural constituent of cytoskeleton. Predicted to be involved in microtubule cytoskeleton organization and mitotic cell cycle. Predicted to be located in intercellular bridge and mitotic spindle. Predicted to be active in cytoplasm and microtubule. Orthologous to human TUBB6 (tubulin beta 6 class V); PARTICIPATES IN phagocytosis pathway; INTERACTS WITH (+)-schisandrin B; 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC307351; MGC116110; RGD1305887; similar to RIKEN cDNA 2310057H16; tubulin beta-6 chain; tubulin, beta 6

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TUBB6 (tubulin beta 6 class V)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tubb6 (tubulin, beta 6 class V)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tubb6 (tubulin beta 6 class V)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TUBB6 (tubulin beta 6 class V)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TUBB6 (tubulin beta 6 class V)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tubb6 (tubulin beta 6 class V)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TUBB6 (tubulin beta 6 class V)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TUBB6 (tubulin beta 6 class V)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tubb6 (tubulin beta 6 class V)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TUBB3 (tubulin beta 3 class III)	HGNC	OrthoDB
Homo sapiens (human):	TUBB2A (tubulin beta 2A class IIa)	HGNC	OrthoDB
Homo sapiens (human):	TUBB4A (tubulin beta 4A class IVa)	HGNC	OrthoDB
Homo sapiens (human):	TUBB4B (tubulin beta 4B class IVb)	HGNC	OrthoDB
Homo sapiens (human):	TUBB2B (tubulin beta 2B class IIb)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	TUBB6 (tubulin beta 6 class V)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tubb6 (tubulin, beta 6 class V)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tubb6 (tubulin, beta 6 class V)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TUB2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tbb-6	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	tbb-2	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	tubb6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	63,213,287 - 63,222,926 (+)	NCBI		GRCr8
mRatBN7.2	18	60,943,394 - 60,953,031 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	60,943,375 - 60,954,418 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	63,013,749 - 63,023,408 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	63,712,512 - 63,722,171 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	61,564,766 - 61,574,430 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	63,130,542 - 63,140,181 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	63,130,542 - 63,140,181 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	62,314,821 - 62,324,460 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	63,919,776 - 63,929,415 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	63,992,976 - 64,002,616 (+)	NCBI
Celera	18	59,049,986 - 59,059,625 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 18p deletion syndrome (ISO)

Congenital Facial Palsy with Ptosis and Velopharyngeal Dysfunction (ISO)

dystonia (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

intellectual disability (ISO)

optic atrophy 12 (ISO)

ptosis (ISO)

spastic ataxia 5 (ISO)

spinocerebellar ataxia type 28 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (EXP,ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-acetamidofluorene (ISO)

2-amino-4,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

butan-1-ol (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

captan (ISO)

carbamazepine (ISO)

carbofuran (EXP)

carbon nanotube (ISO)

carbonyl sulfide (EXP)

cefaloridine (EXP)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (EXP)

clofibrate (ISO)

clozapine (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

D-glucose (ISO)

decabromodiphenyl ether (ISO)

dextran sulfate (ISO)

dibutyl phthalate (EXP,ISO)

dichloroacetic acid (ISO)

dioxygen (EXP,ISO)

dopamine (EXP)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

endosulfan (EXP)

fenamidone (ISO)

fenoldopam (EXP)

fipronil (EXP)

folic acid (ISO)

folpet (ISO)

furan (ISO)

genistein (ISO)

glafenine (EXP)

glucose (ISO)

glycidyl methacrylate (ISO)

hydralazine (ISO)

hydrogen sulfide (ISO)

indole-3-methanol (EXP)

indometacin (EXP)

inulin (ISO)

isoprenaline (EXP)

ivermectin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

leflunomide (EXP,ISO)

levofloxacin (EXP)

methapyrilene (EXP)

methimazole (EXP)

methotrexate (EXP)

methoxychlor (EXP)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP)

naphthalene (ISO)

nickel atom (ISO)

Nonylphenol (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylephrine (EXP)

phenylmercury acetate (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP,ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tolcapone (EXP)

topotecan (EXP,ISO)

toxaphene (EXP)

tributylstannane (ISO)

trimellitic anhydride (ISO)

Triptolide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

microtubule cytoskeleton organization (IBA)

mitotic cell cycle (IBA)

Cellular Component

cytoplasm (IBA)

intercellular bridge (ISO)

microtubule (IBA,ISO)

microtubule cytoskeleton (ISO)

mitotic spindle (ISO)

Molecular Function

GTP binding (IBA)

GTPase activity (IEA)

protein binding (ISO)

structural constituent of cytoskeleton (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

phagocytosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:19056867	PMID:21525035	PMID:21630459	PMID:23106098	PMID:23533145	PMID:25931508	PMID:35352799

Genomics

Comparative Map Data

Tubb6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	63,213,287 - 63,222,926 (+)	NCBI		GRCr8
mRatBN7.2	18	60,943,394 - 60,953,031 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	60,943,375 - 60,954,418 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	63,013,749 - 63,023,408 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	63,712,512 - 63,722,171 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	61,564,766 - 61,574,430 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	63,130,542 - 63,140,181 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	63,130,542 - 63,140,181 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	62,314,821 - 62,324,460 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	63,919,776 - 63,929,415 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	63,992,976 - 64,002,616 (+)	NCBI
Celera	18	59,049,986 - 59,059,625 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

TUBB6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	12,307,669 - 12,329,826 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	12,307,669 - 12,344,320 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	18	12,307,668 - 12,329,825 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	12,298,257 - 12,316,568 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	18	12,298,256 - 12,316,567	NCBI
Celera	18	12,191,548 - 12,207,217 (+)	NCBI		Celera
Cytogenetic Map	18	p11.21	NCBI
HuRef	18	12,262,529 - 12,280,345 (+)	NCBI		HuRef
CHM1_1	18	12,307,671 - 12,325,969 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	18	12,470,687 - 12,492,842 (+)	NCBI		T2T-CHM13v2.0

Tubb6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	67,523,801 - 67,535,819 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	67,523,787 - 67,535,819 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	67,390,731 - 67,402,749 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	67,390,717 - 67,402,749 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	67,550,385 - 67,562,403 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	67,516,100 - 67,528,118 (+)	NCBI		MGSCv36	mm8
Celera	18	68,666,590 - 68,679,839 (+)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	39.96	NCBI

Tubb6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	1,070,858 - 1,081,385 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955402	1,071,135 - 1,081,385 (-)	NCBI	ChiLan1.0	ChiLan1.0

TUBB6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	25,714,533 - 25,737,628 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	11,408,762 - 11,430,225 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	1,998,428 - 2,020,202 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	17,111,755 - 17,130,003 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

TUBB6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	77,728,876 - 77,746,759 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	77,728,180 - 77,749,270 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	77,129,864 - 77,147,748 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	77,787,314 - 77,805,341 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	77,786,581 - 77,807,852 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	77,483,759 - 77,502,054 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	77,530,924 - 77,549,265 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	77,817,817 - 77,835,721 (+)	NCBI		UU_Cfam_GSD_1.0

Tubb6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	964,281 - 976,540 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936626	188,881 - 204,884 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936626	192,191 - 204,827 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TUBB6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	97,229,868 - 97,240,662 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	97,233,639 - 97,240,692 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	90,808,459 - 90,814,364 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TUBB6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	70,870,576 - 70,888,560 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	70,870,566 - 70,888,099 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	45,896,634 - 45,918,689 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tubb6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624770	19,580,623 - 19,590,617 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tubb6
31 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	47
Count of miRNA genes:	42
Interacting mature miRNAs:	44
Transcripts:	ENSRNOT00000024947
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	49999958	65845095	Rat
2293658	Bmd23	Bone mineral density QTL 23	7.3	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	18	51464733	63636873	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	52292875	65845095	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	52292875	73997283	Rat
1600375	Mcs22	Mammary carcinoma susceptibility QTL 22	3.3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	52539763	63933058	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	52539763	69140759	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	52539763	76104388	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	52539763	76104388	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	52539763	76104388	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	52539763	76104388	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	52539763	76104388	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	52539763	76104388	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	52539763	76104388	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	52539863	65844950	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	54709769	83828827	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	58805687	63636873	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	59172115	83828827	Rat
2312600	Bp341	Blood pressure QTL 341		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59330409	70263868	Rat
2301969	Bp324	Blood pressure QTL 324	4.05		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	18	59712417	76477814	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59796478	71893566	Rat
6903353	Bp353	Blood pressure QTL 353	2.8		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	59796478	83828827	Rat
6903356	Bp354	Blood pressure QTL 354	4.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59796478	83828827	Rat
61384	Bp48	Blood pressure QTL 48	19.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	60622311	77209844	Rat
631675	Iddm15	Insulin dependent diabetes mellitus QTL 15			urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	18	60622311	77209844	Rat

Markers in Region

RH65263

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,952,196 - 60,952,323 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	63,139,347 - 63,139,473	NCBI	Rnor6.0
Rnor_5.0	18	62,323,626 - 62,323,752	UniSTS	Rnor5.0
RGSC_v3.4	18	63,928,581 - 63,928,707	UniSTS	RGSC3.4
Celera	18	59,058,791 - 59,058,917	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

RH134041

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,952,828 - 60,953,009 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	63,139,979 - 63,140,159	NCBI	Rnor6.0
Rnor_5.0	18	62,324,258 - 62,324,438	UniSTS	Rnor5.0
RGSC_v3.4	18	63,929,213 - 63,929,393	UniSTS	RGSC3.4
Celera	18	59,059,423 - 59,059,603	UniSTS
RH 3.4 Map	18	617.0	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

PMC156124P3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,951,906 - 60,952,204 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	63,139,057 - 63,139,354	NCBI	Rnor6.0
Rnor_5.0	18	62,323,336 - 62,323,633	UniSTS	Rnor5.0
RGSC_v3.4	18	63,928,291 - 63,928,588	UniSTS	RGSC3.4
Celera	18	59,058,501 - 59,058,798	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	37	33	24	8	24	2	5	55	21	33	11	2
Low		6	24	17	11	17	6	6	19	14	8		6
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000024947 ⟹ ENSRNOP00000024947

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	60,943,375 - 60,953,032 (+)	Ensembl
Rnor_6.0 Ensembl	18	63,130,542 - 63,140,181 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000107745 ⟹ ENSRNOP00000081460

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	60,943,387 - 60,954,418 (+)	Ensembl

RefSeq Acc Id:

NM_001025675 ⟹ NP_001020846

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,213,287 - 63,222,926 (+)	NCBI
mRatBN7.2	18	60,943,394 - 60,953,031 (+)	NCBI
Rnor_6.0	18	63,130,542 - 63,140,181 (+)	NCBI
Rnor_5.0	18	62,314,821 - 62,324,460 (+)	NCBI
RGSC_v3.4	18	63,919,776 - 63,929,415 (+)	RGD
Celera	18	59,049,986 - 59,059,625 (+)	RGD

Sequence:

show sequence

GAGCCAGCGCCCGAGCGCAAACGCGCCCGCCATGAGGGAGATTGTGCACATCCAGGCGGGCCAG
TGTGGGAACCAGATCGGTACCAAGTTTTGGGAAGTGATCAGCGATGAGCACGGCATCGACCCGG
CCGGAGGCTACGTGGGCGACTCGGCGCTGCAGCTGGAGAGGATCAGCGTCTACTACAATGAGTC
ATCCTCTAAGAAGTACGTACCCAGGGCTGCCCTGGTGGACTTGGAGCCCGGCACCATGGACAGC
GTGAGGTCTGGGCCTTTTGGGCAGCTCTTCCGGCCTGACAACTTCATCTTCGGACAGACGGGTG
CCGGGAACAACTGGGCCAAGGGCCACTACACGGAGGGCGCGGAGCTGGTGGACTCGGTGCTGGA
TGTGGTGCGCAAGGAGTGTGAGCACTGCGACTGCCTGCAGGGCTTCCAGCTCACTCACTCGCTG
GGCGGTGGCACGGGCTCGGGCATGGGCACGCTGCTCATCAGCAAGATCCGAGAGGAGTACCCAG
ACCGCATCATGAACACCTTCAGCGTCATGCCGTCTCCCAAGGTCTCAGACACCGTGGTGGAACC
CTACAATGCCACACTGTCGGTGCACCAGCTGGTGGAGAACACCGATGAGACCTACTGCATCGAC
AATGAGGCCCTCTACGACATCTGCTTCCGCACGCTCAAGCTGACCACACCCACTTACGGGGACC
TCAACCACTTGGTATCTGCTACCATGAGTGGTGTCACCACATCACTGCGTTTCCCTGGCCAACT
CAATGCCGACCTGCGCAAGCTGGCTGTGAACATGGTGCCCTTCCCGCGCCTGCATTTCTTCATG
CCCGGATTCGCCCCGCTCACAGCCCGGGGTAGTCAGCAGTACCGTGCCCTGACAGTGCCTGAGC
TCACACAGCAGATGTTCGATGCCAAGAACATGATGGCTGCCTGTGACCCACGCCATGGCCGCTA
CCTGACCGTCGCCACTGTCTTCCGGGGCCCCATGTCCATGAAGGAGGTGGACGAGCAGATGCTG
GCCATCCAGAACAAGAACAGCAGCTACTTTGTGGAGTGGATTCCCAACAACGTGAAGGTAGCCG
TGTGTGACATCCCACCACGGGGCCTGAAGATGGCCTCCACCTTCATAGGCAATAGCACTGCCAT
CCAGGAGCTATTCAAGCGCATCTCAGAGCAGTTCTCAGCCATGTTCCGCCGCAAGGCCTTCCTG
CACTGGTTCACCGGCGAGGGCATGGATGAGATGGAGTTCACCGAGGCCGAGAGCAACATGAATG
ACCTGGTGTCCGAGTACCAGCAGTACCAGGACGCCACAGTCAACGATGGGGAAGAGGCTTTTGA
AGATGAGGATGAAGAAGAGATCAACGAATAGGGGCCGTAAGATGCTACAGTGCATATCTACTTA
GCCCTGATGGTGTGCCAATGGTGCCCTGGTCTGTCACAGGCCCCTCTCAAACCAAATGTACCAC
ACTGTTCCCCAGGTTACCTGGACAGAGAACTTTATCAGAGAATTGGCAGTCCCAGCAGCCCAGG
GAGACTTTATATAGGAACACTGCAAGCTAAGTACGGGGCCATACAGGGCTAAAGAAAGTGACCA
CCCCCGGCCCCATCAGAGTTAGCGGGGGAGTTAGAATAAGGATTTGTTTTTCATCCTTGGTGAT
AAAAACTGAAGCCACACCGTGCTGCCTTAATTGAATACATAATATGGAACTTGATGACAATCCA
TTCATAATAAAATGCTAAACCTGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020846	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97977	(Get FASTA)	NCBI Sequence Viewer
	EDM14728	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024947
	ENSRNOP00000024947.3
	ENSRNOP00000081460.1

RefSeq Acc Id:

NP_001020846 ⟸ NM_001025675

- UniProtKB:

Q4QQV0 (UniProtKB/TrEMBL), A6IXU7 (UniProtKB/TrEMBL), A0A8I5ZT08 (UniProtKB/TrEMBL), F7FF15 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLERISVYYNESSSKKYVPRAA
LVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHYTEGAELVDSVLDVVRKECEHCD
CLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQL
VENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVN
MVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGP
MSMKEVDEQMLAIQNKNSSYFVEWIPNNVKVAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQ
FSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQDATVNDGEEAFEDEDEEEINE

hide sequence

RefSeq Acc Id:

ENSRNOP00000024947 ⟸ ENSRNOT00000024947

RefSeq Acc Id:

ENSRNOP00000081460 ⟸ ENSRNOT00000107745

Protein Domains

Tubulin/FtsZ 2-layer sandwich Tubulin/FtsZ GTPase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4QQV0-F1-model_v2	AlphaFold	Q4QQV0	1-447	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700842

Promoter ID:

EPDNEW_R11366

Type:

multiple initiation site

Name:

Tubb6_1

Description:

tubulin, beta 6 class V

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	63,130,523 - 63,130,583	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305887	AgrOrtholog
BioCyc Gene	G2FUF-7144	BioCyc
Ensembl Genes	ENSRNOG00000018371	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024947	ENTREZGENE
	ENSRNOT00000024947.5	UniProtKB/TrEMBL
	ENSRNOT00000107745.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.600	UniProtKB/TrEMBL
	3.30.1330.20	UniProtKB/TrEMBL
	3.40.50.1440	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7442728	IMAGE-MGC_LOAD
InterPro	Beta-tubulin_BS	UniProtKB/TrEMBL
	Beta_tubulin	UniProtKB/TrEMBL
	Tub_FtsZ_C	UniProtKB/TrEMBL
	Tubulin	UniProtKB/TrEMBL
	Tubulin/FtsZ_2-layer-sand-dom	UniProtKB/TrEMBL
	Tubulin/FtsZ_C_sf	UniProtKB/TrEMBL
	Tubulin/FtsZ_GTPase_sf	UniProtKB/TrEMBL
	Tubulin_C	UniProtKB/TrEMBL
	Tubulin_CS	UniProtKB/TrEMBL
	Tubulin_FtsZ_GTPase	UniProtKB/TrEMBL
KEGG Report	rno:307351	UniProtKB/TrEMBL
MGC_CLONE	MGC:116110	IMAGE-MGC_LOAD
NCBI Gene	307351	ENTREZGENE
PANTHER	Tubulin	UniProtKB/TrEMBL
	TUBULIN BETA-6 CHAIN	UniProtKB/TrEMBL
Pfam	Tubulin	UniProtKB/TrEMBL
	Tubulin_C	UniProtKB/TrEMBL
PhenoGen	Tubb6	PhenoGen
PRINTS	BETATUBULIN	UniProtKB/TrEMBL
	TUBULIN	UniProtKB/TrEMBL
PROSITE	TUBULIN	UniProtKB/TrEMBL
	TUBULIN_B_AUTOREG	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018371	RatGTEx
SMART	Tubulin	UniProtKB/TrEMBL
	Tubulin_C	UniProtKB/TrEMBL
Superfamily-SCOP	Tub_FtsZ_C	UniProtKB/TrEMBL
	Tubulin_FtsZ	UniProtKB/TrEMBL
UniProt	A0A8I5ZT08	ENTREZGENE, UniProtKB/TrEMBL
	A6IXU7	ENTREZGENE, UniProtKB/TrEMBL
	F7FF15	ENTREZGENE, UniProtKB/TrEMBL
	Q4QQV0	ENTREZGENE
UniProt Secondary	Q4QQV0	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-10-19	Tubb6	tubulin, beta 6 class V	Tubb6	tubulin, beta 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-10-12	Tubb6	tubulin, beta 6	Tubb6	tubulin, beta 6 class V	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-10-10	Tubb6	tubulin, beta 6 class V	Tubb6	tubulin, beta 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Tubb6	tubulin, beta 6	RGD1305887	similar to RIKEN cDNA 2310057H16	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1305887	similar to RIKEN cDNA 2310057H16	RGD1305887_predicted	similar to RIKEN cDNA 2310057H16 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1305887_predicted	similar to RIKEN cDNA 2310057H16 (predicted)	LOC307351_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC307351_predicted	similar to RIKEN cDNA 2310057H16 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)