Naprt (nicotinate phosphoribosyltransferase)

Gene: Naprt (nicotinate phosphoribosyltransferase) Rattus norvegicus

Analyze

Symbol:

Naprt

Name:

nicotinate phosphoribosyltransferase

RGD ID:

1302945

Description:

Enables nicotinate phosphoribosyltransferase activity. Involved in NAD biosynthetic process. Predicted to be active in cytosol. Orthologous to human NAPRT (nicotinate phosphoribosyltransferase); PARTICIPATES IN nicotinamide adenine dinucleotide biosynthesis, the salvage pathway; monoterpenoid biosynthetic pathway; niacin metabolic pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC315085; Naprt1; NAPRTase; nicotinate phosphoribosyltransferase domain containing 1; nicotinate phosphoribosyltransferase domain-containing protein 1; nicotinate phosphoribosyltransferase-like protein

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NAPRT (nicotinate phosphoribosyltransferase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Naprt (nicotinate phosphoribosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Naprt (nicotinate phosphoribosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NAPRT (nicotinate phosphoribosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NAPRT (nicotinate phosphoribosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Naprt (nicotinate phosphoribosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NAPRT (nicotinate phosphoribosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NAPRT (nicotinate phosphoribosyltransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Naprt (nicotinate phosphoribosyltransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NAPRT (nicotinate phosphoribosyltransferase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	naprt (nicotinate phosphoribosyltransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Naprt	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nprt-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	naprt	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	109,457,328 - 109,460,817 (-)	NCBI		GRCr8
mRatBN7.2	7	107,576,645 - 107,580,102 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	107,576,627 - 107,580,102 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	109,316,156 - 109,319,613 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	111,539,834 - 111,543,291 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	111,485,758 - 111,489,215 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	116,922,979 - 116,926,436 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	116,922,944 - 116,926,555 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	116,814,946 - 116,818,403 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	113,865,273 - 113,868,730 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	113,899,517 - 113,902,960 (-)	NCBI
Celera	7	103,933,643 - 103,937,100 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brown-Vialetto-Van Laere syndrome 2 (ISO)

epidermolysis bullosa simplex with muscular dystrophy (ISO)

genetic disease (ISO)

holoprosencephaly (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

amitrole (EXP)

amphetamine (EXP)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

cobalt dichloride (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

cyproconazole (ISO)

dibenzofurans (ISO)

dibutyl phthalate (EXP,ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

fenthion (ISO)

folic acid (ISO)

FR900359 (ISO)

ivermectin (ISO)

methapyrilene (ISO)

methimazole (EXP)

ochratoxin A (EXP)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propiconazole (ISO)

Propiverine (EXP)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

triazines (ISO)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

NAD biosynthetic process (IDA)

NAD salvage (IBA,IEA)

response to oxidative stress (IEA,ISO,ISS)

Cellular Component

cytosol (IBA,IEA,ISO,ISS)

Molecular Function

metal ion binding (IEA)

nicotinate phosphoribosyltransferase activity (IBA,IDA,IEA,ISO,ISS)

protein binding (ISO)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

monoterpenoid biosynthetic pathway (IEA)

niacin metabolic pathway (IEA)

nicotinamide adenine dinucleotide biosynthesis, the salvage pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The secret life of NAD+: an old metabolite controlling new metabolic signaling pathways.	Houtkooper RH, etal., Endocr Rev. 2010 Apr;31(2):194-223. doi: 10.1210/er.2009-0026. Epub 2009 Dec 9.
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Information Derived from GenBank Report	RGD, Sept. 2003
8.	NAD+ biosynthesis and metabolic fluxes of tryptophan in hepatocytes isolated from rats fed a clofibrate-containing diet.	Shin M, etal., Biochem Pharmacol. 1996 Jul 26;52(2):247-52.

Additional References at PubMed

PMID:17604275	PMID:19056867	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Naprt
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	109,457,328 - 109,460,817 (-)	NCBI		GRCr8
mRatBN7.2	7	107,576,645 - 107,580,102 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	107,576,627 - 107,580,102 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	109,316,156 - 109,319,613 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	111,539,834 - 111,543,291 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	111,485,758 - 111,489,215 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	116,922,979 - 116,926,436 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	116,922,944 - 116,926,555 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	116,814,946 - 116,818,403 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	113,865,273 - 113,868,730 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	113,899,517 - 113,902,960 (-)	NCBI
Celera	7	103,933,643 - 103,937,100 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

NAPRT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	143,572,874 - 143,578,330 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	143,574,785 - 143,578,649 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	144,656,955 - 144,660,500 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	144,728,098 - 144,731,636 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	8	140,967,186 - 140,970,744 (-)	NCBI		Celera
Cytogenetic Map	8	q24.3	NCBI
HuRef	8	139,908,475 - 139,912,033 (-)	NCBI		HuRef
CHM1_1	8	144,697,179 - 144,700,655 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	144,723,979 - 144,727,726 (-)	NCBI		T2T-CHM13v2.0

Naprt
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	75,762,812 - 75,766,330 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	75,762,805 - 75,766,330 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	75,890,963 - 75,894,481 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	75,890,956 - 75,894,481 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	75,721,394 - 75,724,911 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	75,718,219 - 75,721,736 (-)	NCBI		MGSCv36	mm8
Celera	15	77,391,944 - 77,395,461 (-)	NCBI		Celera
Cytogenetic Map	15	D3	NCBI
cM Map	15	35.05	NCBI

Naprt
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955454	2,280,223 - 2,283,613 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955454	2,280,223 - 2,283,613 (-)	NCBI	ChiLan1.0	ChiLan1.0

NAPRT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	161,058,197 - 161,062,053 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	136,575,884 - 136,579,734 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	140,328,119 - 140,331,972 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	143,343,280 - 143,347,347 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	143,340,928 - 143,362,971 (-)	Ensembl	panpan1.1		panPan2

NAPRT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	37,235,985 - 37,239,261 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	37,235,045 - 37,239,224 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	37,192,494 - 37,195,827 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	37,707,832 - 37,711,165 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	37,707,854 - 37,712,418 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	37,382,167 - 37,385,501 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	37,499,120 - 37,502,451 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	37,980,305 - 37,983,640 (-)	NCBI		UU_Cfam_GSD_1.0

Naprt
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	1,128,622 - 1,131,790 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	8,554,641 - 8,557,919 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	8,554,739 - 8,557,889 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NAPRT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	983,423 - 986,748 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	983,428 - 986,750 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

NAPRT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	137,794,933 - 137,799,145 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	137,792,993 - 137,798,658 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	2,094,565 - 2,098,729 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Naprt
11 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	128
Count of miRNA genes:	112
Interacting mature miRNAs:	121
Transcripts:	ENSRNOT00000010637
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat

Markers in Region

RH143647

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	107,580,000 - 107,580,100 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	116,926,335 - 116,926,434	NCBI	Rnor6.0
Rnor_5.0	7	116,818,302 - 116,818,401	UniSTS	Rnor5.0
RGSC_v3.4	7	113,868,629 - 113,868,728	UniSTS	RGSC3.4
Celera	7	103,936,999 - 103,937,098	UniSTS
RH 3.4 Map	7	782.9	UniSTS
Cytogenetic Map	7	q34	UniSTS

AI410930

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	107,576,614 - 107,576,764 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	116,922,949 - 116,923,098	NCBI	Rnor6.0
Rnor_5.0	7	116,814,916 - 116,815,065	UniSTS	Rnor5.0
RGSC_v3.4	7	113,865,243 - 113,865,392	UniSTS	RGSC3.4
Celera	7	103,933,613 - 103,933,762	UniSTS
RH 3.4 Map	7	785.1	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	23	37	37	9	37			11	29	22	11
Low		20	20	4	10	4	8	11	63	6	19		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_207609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC126537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY214330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000010637 ⟹ ENSRNOP00000010637

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	107,576,663 - 107,580,102 (-)	Ensembl
Rnor_6.0 Ensembl	7	116,922,944 - 116,926,555 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000099056 ⟹ ENSRNOP00000079417

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	107,576,627 - 107,580,102 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000101682 ⟹ ENSRNOP00000084441

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	107,576,663 - 107,580,024 (-)	Ensembl

RefSeq Acc Id:

NM_207609 ⟹ NP_997492

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	109,457,360 - 109,460,817 (-)	NCBI
mRatBN7.2	7	107,576,645 - 107,580,102 (-)	NCBI
Rnor_6.0	7	116,922,979 - 116,926,436 (-)	NCBI
Rnor_5.0	7	116,814,946 - 116,818,403 (-)	NCBI
RGSC_v3.4	7	113,865,273 - 113,868,730 (-)	RGD
Celera	7	103,933,643 - 103,937,100 (-)	RGD

Sequence:

show sequence

GCGTGAGTCGGTTGTCTGGACCTGTGCCTTAGGGGGTGGAGTAGGGCGCCATTAATCCAGAGCC
TGTGTACCCTGCGGAATGGAGATGGAGCTGGACGACCAGGGGCGCATGGTGGTGCGGCCGCTGC
TCACCGACCTCTACCAGGCTACAATGGGGCTGGGATACTGGCGTGCGGGCCGGGCATGTGAGGA
AGCAGAGTTCGAACTCTTCTTCCGCCACTGCCCCTTCGGAGGTTCCTTTGCCCTGACCGCTGGC
CTGCAGGACTGTATACGCTTTCTTCGCGCCTTCCGTCTGCGCGATGCAGATGTGCAGTTCCTGG
CTTCAGTGCTACCCCCAGACACTGACCCTGCGTTCTTCGAGCACCTTCGAGCCCTTGACTGCTC
TCGGGTGTCGGTGCGAGCCCTGCCGGAGGGTTCCCTCGCTTTCCCTGGTGTGCCACTTCTGCAG
GTGTCGGGGCCTCTTCTTCTGGTACAGCTGCTAGAGACTCCGCTGCTGTGTCTGGTCAGCTACG
CTAGCCTCGTAGCCACCAATGCTGCTCGGCTTCGCTTGATTGCAGGACCGGACAAGAGACTACT
AGAGATGGGCTTGCGGCGAGCTCAGGGTCCCGATGGGGGCTTCACGGCCTCCATTTACAGCTAC
CTGGGTGGGTTTGACAGCAGCAGCAACACACTTGCTGGACAACTGAGAGGTGTGCCCGTGGCAG
GGACCCTGGCCCACTCCTTCATCACTTCATTTTTGGGTAGTGAGGTACCCCCTGACCCGATGTT
GGCTCCAGCTTCTAGTGAGGGCCCTGCCGTGGACCTGCCTGCCAGTGTAAATTTGTGGCTGAAG
CATGTGTGCATCTACTTGGGGCTGGAGGAGCGGGAGCCACATCTGGGGGAACGAGCAGCATTTG
TGGCCTATGCGCTGGCCTTCCCCCGGGCTTTCCAGGGCCTGCTAGATTCCTACAGCGTACGCAG
GAGTGGTCTTCCTAACTTCCTGGCAGTAGCCCTGGCACTTGGGGAACTGGGCTACAGGGCAGTG
GGTGTGAGGCTGGACAGCGGTGACCTGCTTCAGCAGGCTAAGGAGATCCGAGGGATCTTTCGAA
CTGTTGGTGCTGAGTTCCAGATGCCCTGGCTAGAGTTCGTTCCCATTGCAGTCAGCAACAACAT
TGACGAGAAGGAGCTGGCAAGGCTAGCCCAAAAGGGCAGTGAGGTGAATGTCATCGGCATTGGC
ACCAATGTGGTCACTTGTCCCAAACAGCCTTCTATGGGCTGTGTCTACAAGCTGGTGTCCGTGG
GAGGCCAACCTCGAATAAAGCTGACGGAGGAATCCCAGAAGGAAACACTGCCAGGGAGCAAGGC
TGCCTTCCGGTTCCTGGTCTCTGAGGGGTCTTTGCTACTGGACCTACTGCAGTTAGCAGAAGAG
CCCCCACCCAAGGCTGGGCAGGAACTCAGGGTATGGCTTCAGGGGGCCCAGGAGCCCTGCACTG
TGAAGCCAGCCCAGGTGGAGCCATTGCTGCGACTGTACCTGCAACAGGGACAGCCGTATGAACC
ACTTCCATCTCTGGAAGAGTCCAGAGCCTTTGCCCAGCAGTCCCTGAGCCGCCTCCGACCAGCT
CATAAGCAGCTGCAGAACCCTGCTGTATACCAGGTCGCATTGTCAGAGAAGCTTCGGGCACTGG
TGGACAGTCTGAGTGCTCGAGGTGCCCTGTGAAAAAGATCACAAAGAACACGACTCTCTCTTCC
CACAACTTTGTCAGCCACGTGTCATTAGTTCACAAATTTCTGCTGCTCACTTGGGACTTCCAGG
GCTGGGCTGGAGTTAGGAGTATGAGGAGGTGCAGCCCCGGTGAATAAAAAAAAAAAAAAAAAAA
AA

hide sequence

RefSeq Acc Id:

XM_039079238 ⟹ XP_038935166

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	109,457,328 - 109,460,143 (-)	NCBI
mRatBN7.2	7	107,576,645 - 107,579,636 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_997492	(Get FASTA)	NCBI Sequence Viewer
	XP_038935166	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP69608	(Get FASTA)	NCBI Sequence Viewer
	EDM16045	(Get FASTA)	NCBI Sequence Viewer
	EDM16046	(Get FASTA)	NCBI Sequence Viewer
	EDM16047	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010637
	ENSRNOP00000010637.4
	ENSRNOP00000079417.1
	ENSRNOP00000084441.1
GenBank Protein	Q6XQN1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_997492 ⟸ NM_207609

- UniProtKB:

Q6XQN1 (UniProtKB/Swiss-Prot), G3V709 (UniProtKB/TrEMBL), A6HS25 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEMELDDQGRMVVRPLLTDLYQATMGLGYWRAGRACEEAEFELFFRHCPFGGSFALTAGLQDCI
RFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSRVSVRALPEGSLAFPGVPLLQVSGPL
LLVQLLETPLLCLVSYASLVATNAARLRLIAGPDKRLLEMGLRRAQGPDGGFTASIYSYLGGFD
SSSNTLAGQLRGVPVAGTLAHSFITSFLGSEVPPDPMLAPASSEGPAVDLPASVNLWLKHVCIY
LGLEEREPHLGERAAFVAYALAFPRAFQGLLDSYSVRRSGLPNFLAVALALGELGYRAVGVRLD
SGDLLQQAKEIRGIFRTVGAEFQMPWLEFVPIAVSNNIDEKELARLAQKGSEVNVIGIGTNVVT
CPKQPSMGCVYKLVSVGGQPRIKLTEESQKETLPGSKAAFRFLVSEGSLLLDLLQLAEEPPPKA
GQELRVWLQGAQEPCTVKPAQVEPLLRLYLQQGQPYEPLPSLEESRAFAQQSLSRLRPAHKQLQ
NPAVYQVALSEKLRALVDSLSARGAL

hide sequence

RefSeq Acc Id:

ENSRNOP00000010637 ⟸ ENSRNOT00000010637

RefSeq Acc Id:	XP_038935166 ⟸ XM_039079238
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000079417 ⟸ ENSRNOT00000099056

RefSeq Acc Id:

ENSRNOP00000084441 ⟸ ENSRNOT00000101682

Protein Domains

Nicotinate phosphoribosyltransferase C-terminal Nicotinate phosphoribosyltransferase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6XQN1-F1-model_v2	AlphaFold	Q6XQN1	1-538	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695394

Promoter ID:

EPDNEW_R5917

Type:

multiple initiation site

Name:

Naprt_1

Description:

nicotinate phosphoribosyltransferase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	116,926,379 - 116,926,439	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1302945	AgrOrtholog
BioCyc Gene	G2FUF-32977	BioCyc
BioCyc Pathway	PWY3O-4107 [NAD salvage pathway V (PNC V cycle)]	BioCyc
BioCyc Pathway Image	PWY3O-4107	BioCyc
Ensembl Genes	ENSRNOG00000007939	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010637	ENTREZGENE
	ENSRNOT00000010637.6	UniProtKB/TrEMBL
	ENSRNOT00000099056.1	UniProtKB/TrEMBL
	ENSRNOT00000101682.1	UniProtKB/TrEMBL
Gene3D-CATH	3.20.20.70	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	nicotinate phosphoribosyltransferase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Aldolase_TIM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAPRTase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAPRTase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nic_PRibTrfase-Fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nic_PRibTrfase_pncB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nicotinate_pribotase-like_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:315085	UniProtKB/Swiss-Prot
NCBI Gene	315085	ENTREZGENE
PANTHER	NICOTINATE PHOSPHORIBOSYLTRANSFERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11098	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	NAPRTase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAPRTase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Naprt	PhenoGen
PIRSF	NAPRT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007939	RatGTEx
Superfamily-SCOP	Nicotinate/Quinolinate PRTase N-terminal domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF51690	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZMZ2_RAT	UniProtKB/TrEMBL
	A0A8I5ZZB7_RAT	UniProtKB/TrEMBL
	A6HS25	ENTREZGENE, UniProtKB/TrEMBL
	G3V709	ENTREZGENE, UniProtKB/TrEMBL
	PNCB_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-10	Naprt	nicotinate phosphoribosyltransferase	Naprt1	nicotinate phosphoribosyltransferase domain containing 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Naprt1	nicotinate phosphoribosyltransferase domain containing 1	LOC315085	nicotinate phosphoribosyltransferase-like protein	Symbol and Name updated	1299863	APPROVED
2005-02-14	LOC315085	nicotinate phosphoribosyltransferase-like protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

BioCyc Pathways