Advanced Search (OLGA)

Gene: Necap2 (NECAP endocytosis associated 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Necap2

Name:

NECAP endocytosis associated 2

RGD ID:

735063

Description:

Predicted to be involved in endocytosis. Predicted to be located in clathrin-coated pit. Predicted to be part of clathrin vesicle coat. Orthologous to human NECAP2 (NECAP endocytosis associated 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

adaptin ear-binding coat-associated protein 2; adaptin-ear-binding coat-associated protein 2; MGC72598; NECAP-2; Unknown (protein for MGC:72598)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NECAP2 (NECAP endocytosis associated 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Necap2 (NECAP endocytosis associated 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Necap2 (NECAP endocytosis associated 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NECAP2 (NECAP endocytosis associated 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NECAP2 (NECAP endocytosis associated 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Necap2 (NECAP endocytosis associated 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NECAP2 (NECAP endocytosis associated 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NECAP2 (NECAP endocytosis associated 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Necap2 (NECAP endocytosis associated 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NECAP2 (NECAP endocytosis associated 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Necap2 (NECAP endocytosis associated 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	necap2 (NECAP endocytosis associated 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ncap-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9132	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	necap2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	158,653,347 - 158,665,761 (-)	NCBI		GRCr8
mRatBN7.2	5	153,370,338 - 153,382,753 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	153,370,338 - 153,382,729 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	156,058,617 - 156,070,978 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	157,831,889 - 157,844,250 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	157,821,074 - 157,833,435 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	159,589,856 - 159,602,260 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	159,589,881 - 159,602,251 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	163,302,181 - 163,314,578 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	159,924,712 - 159,937,073 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	159,934,907 - 159,947,261 (-)	NCBI
Celera	5	151,734,989 - 151,747,350 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Necap2	Rat	chromosome 1p36 deletion syndrome		ISO	NECAP2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 1p36 deletion syndrome	ClinVar
Necap2	Rat	prostate cancer		ISO	NECAP2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Malignant tumor of prostate	ClinVar	PMID:23265383

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Necap2	Rat	(+)-catechin	multiple interactions	ISO	NECAP2 (Homo sapiens)	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of NECAP2 mRNA	CTD	PMID:24763279
Necap2	Rat	1,2-dimethylhydrazine	increases expression	ISO	Necap2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of NECAP2 mRNA	CTD	PMID:22206623
Necap2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Necap2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of NECAP2 mRNA	CTD	PMID:21570461
Necap2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of NECAP2 mRNA	CTD	PMID:34747641
Necap2	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of NECAP2 mRNA	CTD	PMID:28959563
Necap2	Rat	all-trans-retinoic acid	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	Tretinoin results in increased expression of NECAP2 mRNA	CTD	PMID:33167477
Necap2	Rat	antirheumatic drug	decreases expression	ISO	NECAP2 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of NECAP2 mRNA	CTD	PMID:24449571
Necap2	Rat	aristolochic acid A	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of NECAP2 mRNA	CTD	PMID:33212167
Necap2	Rat	arsenite(3-)	multiple interactions	ISO	NECAP2 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to NECAP2 mRNA]	CTD	PMID:32406909
Necap2	Rat	benzo[a]pyrene	increases methylation	ISO	NECAP2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of NECAP2 promoter	CTD	PMID:27901495
Necap2	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	NECAP2 (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397
Necap2	Rat	beta-lapachone	decreases expression	ISO	NECAP2 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of NECAP2 mRNA	CTD	PMID:38218311
Necap2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of NECAP2 mRNA	CTD	PMID:25181051
Necap2	Rat	bisphenol A	increases expression	ISO	Necap2 (Mus musculus)	6480464	bisphenol A results in increased expression of NECAP2 mRNA	CTD	PMID:32156529
Necap2	Rat	bisphenol A	decreases expression	ISO	NECAP2 (Homo sapiens)	6480464	bisphenol A results in decreased expression of NECAP2 protein	CTD	PMID:33376534
Necap2	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Genistein] results in increased methylation of NECAP2 gene	CTD	PMID:28505145
Necap2	Rat	bisphenol AF	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	bisphenol AF results in increased expression of NECAP2 protein	CTD	PMID:34186270
Necap2	Rat	Bisphenol B	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	bisphenol B results in increased expression of NECAP2 protein	CTD	PMID:34186270
Necap2	Rat	caffeine	affects phosphorylation	ISO	NECAP2 (Homo sapiens)	6480464	Caffeine affects the phosphorylation of NECAP2 protein	CTD	PMID:35688186
Necap2	Rat	carbon nanotube	increases expression	ISO	Necap2 (Mus musculus)	6480464	Nanotubes and Carbon analog results in increased expression of NECAP2 mRNA	CTD	PMID:25554681
Necap2	Rat	CGP 52608	multiple interactions	ISO	NECAP2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to NECAP2 gene]	CTD	PMID:28238834
Necap2	Rat	chlorpyrifos	increases expression	ISO	Necap2 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of NECAP2 mRNA	CTD	PMID:37019170
Necap2	Rat	crocidolite asbestos	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	Asbestos and Crocidolite results in increased expression of NECAP2 mRNA	CTD	PMID:18687144
Necap2	Rat	cyclosporin A	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	Cyclosporine results in increased expression of NECAP2 mRNA	CTD	PMID:20106945
Necap2	Rat	Dibutyl phosphate	affects expression	ISO	NECAP2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of NECAP2 mRNA	CTD	PMID:37042841
Necap2	Rat	dibutyl phthalate	decreases expression	ISO	Necap2 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of NECAP2 mRNA	CTD	PMID:21266533
Necap2	Rat	doxorubicin	decreases expression	ISO	NECAP2 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of NECAP2 mRNA	CTD	PMID:29803840
Necap2	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of NECAP2 mRNA	CTD	PMID:29391264
Necap2	Rat	enzyme inhibitor	multiple interactions	ISO	NECAP2 (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of NECAP2 protein	CTD	PMID:23301498
Necap2	Rat	fenthion	decreases expression	ISO	Necap2 (Mus musculus)	6480464	Fenthion results in decreased expression of NECAP2 mRNA	CTD	PMID:34813904
Necap2	Rat	folic acid	decreases expression	ISO	Necap2 (Mus musculus)	6480464	Folic Acid results in decreased expression of NECAP2 mRNA	CTD	PMID:25629700
Necap2	Rat	formaldehyde	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	Formaldehyde results in increased expression of NECAP2 mRNA	CTD	PMID:23649840
Necap2	Rat	FR900359	decreases phosphorylation	ISO	NECAP2 (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of NECAP2 protein	CTD	PMID:37730182
Necap2	Rat	genistein	multiple interactions	EXP		6480464	[bisphenol A co-treated with Genistein] results in increased methylation of NECAP2 gene	CTD	PMID:28505145
Necap2	Rat	ivermectin	decreases expression	ISO	NECAP2 (Homo sapiens)	6480464	Ivermectin results in decreased expression of NECAP2 protein	CTD	PMID:32959892
Necap2	Rat	leflunomide	decreases expression	ISO	NECAP2 (Homo sapiens)	6480464	leflunomide results in decreased expression of NECAP2 mRNA	CTD	PMID:28988120
Necap2	Rat	methidathion	decreases expression	ISO	Necap2 (Mus musculus)	6480464	methidathion results in decreased expression of NECAP2 mRNA	CTD	PMID:34813904
Necap2	Rat	methyl methanesulfonate	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of NECAP2 mRNA	CTD	PMID:23649840
Necap2	Rat	paracetamol	affects expression	ISO	Necap2 (Mus musculus)	6480464	Acetaminophen affects the expression of NECAP2 mRNA	CTD	PMID:17562736
Necap2	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of NECAP2 mRNA	CTD	PMID:33387578
Necap2	Rat	phenobarbital	decreases expression	ISO	NECAP2 (Homo sapiens)	6480464	Phenobarbital results in decreased expression of NECAP2 protein	CTD	PMID:35881160
Necap2	Rat	phenobarbital	decreases expression	ISO	Necap2 (Mus musculus)	6480464	Phenobarbital results in decreased expression of NECAP2 protein	CTD	PMID:35881160
Necap2	Rat	pirinixic acid	multiple interactions	ISO	NECAP2 (Homo sapiens)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NECAP2 mRNA	CTD	PMID:19710929
Necap2	Rat	pirinixic acid	multiple interactions	ISO	Necap2 (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of NECAP2 mRNA	CTD	PMID:19710929
Necap2	Rat	resveratrol	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	resveratrol results in increased expression of NECAP2 mRNA	CTD	PMID:19371625
Necap2	Rat	sodium arsenite	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of NECAP2 mRNA	CTD	PMID:38568856
Necap2	Rat	sodium arsenite	decreases expression	ISO	NECAP2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of NECAP2 protein	CTD	PMID:30528433
Necap2	Rat	Soman	increases expression	EXP		6480464	Soman results in increased expression of NECAP2 mRNA	CTD	PMID:19281266
Necap2	Rat	thapsigargin	increases expression	EXP		6480464	Thapsigargin results in increased expression of NECAP2 protein	CTD	PMID:35544339
Necap2	Rat	thiram	increases expression	ISO	NECAP2 (Homo sapiens)	6480464	Thiram results in increased expression of NECAP2 mRNA	CTD	PMID:38568856
Necap2	Rat	titanium dioxide	decreases methylation	ISO	Necap2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of NECAP2 gene	CTD	PMID:35295148
Necap2	Rat	triptonide	increases expression	ISO	Necap2 (Mus musculus)	6480464	triptonide results in increased expression of NECAP2 mRNA	CTD	PMID:33045310
Necap2	Rat	valproic acid	increases methylation	ISO	NECAP2 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of NECAP2 gene	CTD	PMID:29154799
Necap2	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of NECAP2 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Necap2	Rat	endocytosis	involved_in	ISS	UniProtKB:Q9CR95	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Necap2	Rat	endocytosis	involved_in	IEA	InterPro:IPR012466	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Necap2	Rat	endocytosis	involved_in	IEA	UniProtKB-KW:KW-0254	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Necap2	Rat	protein transport	involved_in	IEA	UniProtKB-KW:KW-0653	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Necap2	Rat	vesicle-mediated transport	involved_in	IBA	MGI:1914852 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Necap2	Rat	clathrin vesicle coat	part_of	ISS	UniProtKB:Q9CR95	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Necap2	Rat	clathrin vesicle coat	part_of	IBA	MGI:1913397 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Necap2	Rat	clathrin vesicle coat	part_of	ISO	Necap2 (Mus musculus)	1624291	PMID:14555962	RGD	PMID:14555962
Necap2	Rat	clathrin-coated pit	located_in	ISS	UniProtKB:Q9CR95	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Necap2	Rat	clathrin-coated vesicle membrane	located_in	IEA	UniProtKB-SubCell:SL-0071	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Necap2	Rat	cytoplasmic vesicle	located_in	IEA	UniProtKB-KW:KW-0968	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Necap2	Rat	membrane	located_in	IEA	InterPro:IPR012466	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Necap2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Necap2	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Necap2	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Necap2	Rat	protein binding	enables	ISO	NECAP2 (Homo sapiens)	1624291	UniProtKB:P63010 more ...	RGD	PMID:16189514 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Identification of a family of endocytic proteins that define a new alpha-adaptin ear-binding motif.	Ritter B, etal., EMBO Rep 2003 Nov;4(11):1089-95. Epub 2003 Oct 10.
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:14766980	PMID:15489334	PMID:17762867

Necap2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	158,653,347 - 158,665,761 (-)	NCBI		GRCr8
mRatBN7.2	5	153,370,338 - 153,382,753 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	153,370,338 - 153,382,729 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	156,058,617 - 156,070,978 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	157,831,889 - 157,844,250 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	157,821,074 - 157,833,435 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	159,589,856 - 159,602,260 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	159,589,881 - 159,602,251 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	163,302,181 - 163,314,578 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	159,924,712 - 159,937,073 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	159,934,907 - 159,947,261 (-)	NCBI
Celera	5	151,734,989 - 151,747,350 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

NECAP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	16,440,724 - 16,460,078 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	16,440,721 - 16,460,078 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	16,767,219 - 16,786,573 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	16,639,820 - 16,659,160 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	15,247,104 - 15,266,526 (+)	NCBI		Celera
Cytogenetic Map	1	p36.13	NCBI
HuRef	1	15,284,492 - 15,303,914 (+)	NCBI		HuRef
CHM1_1	1	16,565,964 - 16,585,382 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	15,882,405 - 15,901,764 (+)	NCBI		T2T-CHM13v2.0

Necap2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	140,793,823 - 140,805,672 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	140,793,823 - 140,805,668 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	141,066,512 - 141,078,357 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	141,066,512 - 141,078,357 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	140,622,427 - 140,634,260 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	140,338,593 - 140,350,410 (-)	NCBI		MGSCv36	mm8
Celera	4	142,870,549 - 142,882,374 (-)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	73.35	NCBI

Necap2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955527	1,885,708 - 1,900,877 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955527	1,885,708 - 1,900,424 (-)	NCBI	ChiLan1.0	ChiLan1.0

NECAP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	210,460,649 - 210,480,212 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	209,709,336 - 209,728,893 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	15,578,444 - 15,597,823 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	16,568,847 - 16,588,213 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	16,568,847 - 16,588,213 (+)	Ensembl	panpan1.1		panPan2

NECAP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	81,275,294 - 81,289,405 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	81,276,223 - 81,289,344 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	77,811,466 - 77,825,474 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	81,921,266 - 81,935,269 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	81,917,663 - 81,935,231 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	78,674,282 - 78,688,264 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	79,691,422 - 79,705,149 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	80,759,287 - 80,773,273 (-)	NCBI		UU_Cfam_GSD_1.0

Necap2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	38,067,614 - 38,081,766 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	3,892,608 - 3,906,558 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	3,892,608 - 3,906,548 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NECAP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	75,527,108 - 75,546,843 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	75,527,071 - 75,543,187 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	69,838,982 - 69,856,065 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NECAP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	115,865,118 - 115,882,157 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	115,864,746 - 115,882,392 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	19,343,726 - 19,361,770 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Necap2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	2,543,918 - 2,556,163 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	2,543,826 - 2,557,249 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Necap2
116 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	112
Count of miRNA genes:	94
Interacting mature miRNAs:	101
Transcripts:	ENSRNOT00000011394
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	151113452	164465185	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	151006154	161165494	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat

RH129881

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	153,370,369 - 153,370,549 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	159,589,888 - 159,590,067	NCBI	Rnor6.0
Rnor_5.0	5	163,302,213 - 163,302,392	UniSTS	Rnor5.0
RGSC_v3.4	5	159,924,719 - 159,924,898	UniSTS	RGSC3.4
Celera	5	151,734,996 - 151,735,175	UniSTS
RH 3.4 Map	5	1050.5	UniSTS
Cytogenetic Map	5	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001399087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_199096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_174157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_174158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_174159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006239180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061826	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011394 ⟹ ENSRNOP00000011394

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	153,370,344 - 153,382,729 (-)	Ensembl
Rnor_6.0 Ensembl	5	159,589,881 - 159,602,251 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100304 ⟹ ENSRNOP00000095787

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	153,370,343 - 153,382,729 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108679 ⟹ ENSRNOP00000083128

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	153,370,338 - 153,382,729 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108752 ⟹ ENSRNOP00000085569

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	153,370,338 - 153,382,727 (-)	Ensembl

RefSeq Acc Id:

NM_001399087 ⟹ NP_001386016

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,653,347 - 158,665,751 (-)	NCBI
mRatBN7.2	5	153,370,338 - 153,382,743 (-)	NCBI

RefSeq Acc Id:

NM_001399088 ⟹ NP_001386017

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,653,347 - 158,665,751 (-)	NCBI
mRatBN7.2	5	153,370,338 - 153,382,743 (-)	NCBI

RefSeq Acc Id:

NM_001399089 ⟹ NP_001386018

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,653,347 - 158,665,751 (-)	NCBI
mRatBN7.2	5	153,370,338 - 153,382,743 (-)	NCBI

RefSeq Acc Id:

NM_001399090 ⟹ NP_001386019

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,653,347 - 158,665,751 (-)	NCBI
mRatBN7.2	5	153,370,338 - 153,382,743 (-)	NCBI

RefSeq Acc Id:

NM_199096 ⟹ NP_954527

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,653,347 - 158,665,751 (-)	NCBI
mRatBN7.2	5	153,370,338 - 153,382,743 (-)	NCBI
Rnor_6.0	5	159,589,881 - 159,602,241 (-)	NCBI
Rnor_5.0	5	163,302,181 - 163,314,578 (-)	NCBI
RGSC_v3.4	5	159,924,712 - 159,937,073 (-)	RGD
Celera	5	151,734,989 - 151,747,350 (-)	RGD

Sequence:

show sequence

GGAAGAAGCCGGAAGTCCCGAGAGCTCCGGCGGTAGAGATGGAGGAGAGCGAGTACGAGTCTGTTCTCTGTGTCAAGCCAGAGGTCCATGTCTACCGCATCCCGCCGCGGGCCACCAACCGTGGTTAC
AGGGCCTCAGAATGGCAACTGGACCAGCCATCCTGGAGTGGCCGGCTGCGGATCACTGCGAAAGGGAAGGTGGCCTACATCAAGCTGGAGGACAGGACCTCTGGCCCCAGTGGACCAGTTTCCCGGCA
CCGCTGTGGAGAGTGTGACAGACTCCAGCAGGTACTTCGTTATCCGAATTGAAGATGGAAACGGGCGACGTGCTTTTATTGGGATTGGCTTTGGGGACCGAGGGGACGCCTTTGACTTCAACGTGGCA
TTGCAGGACCATTTCAAGTGGGTGAAGCAGCAGTGCGAGTTTGCAAAACAAGCTCAGAACCCAGATGAAGGCCCCAAGTTGGACCTGGGCTTCAAGGAGGGCCAGACCATCAAGATCAACATCGCAAA
CATGAGAAAGAAGGAAGGAGCAGCTGGGGCCCCAAGAACCAGGCCTGCCAGCGCAGGAGGGCTGAGCCTGCTGCCCCCTCCTCCAGGGGGCAAGATGTCTACACTCATCCCTCCCTCTGGAGAGCAGT
TGTCTGGGGGCTCTCTGGTTCAGCCAGTTTCTGGTTCAGGAGGTGCCACAGAACTCTGGCCACAATCTAAGCCTGCTGCCGCTGCCACTGCTGATATCTGGGGCGACTTCACCAAGTCCACAGGGTCC
CCCTCCAGCCAGTCTCAGCCAGGCACTGGCTGGGTCCAGTTTTGACCTACGTAACCTTTTCCTCAGCCGACTTCTGGGAAGGAGCTGCGTCACCCTGGCCCACGGAAGGAGGCAGATAGTCCTTCCTG
GCTGGCCCCAGGCTCCTTGCCTGGCTGTCTTGACAGCCTGAGCATAAGAAGCAGTAAGTTGGCACTGTGCCACACTGTTGCTGGGGCTCGAGTGCTGCTCAGGCAGAAAACAGGAGCAAACACTCCAG
GGCCCCCAAGCTCATCACCCTCCCCACTGGAGACAACCAGACCTGCCTTCTTCCATCCAGTGATCCTTATTAAACACAGCCCCCAAAGCCCAGAATGGATTGAATTTATGGCCTGGGTTCAGCTCTGC
CTCTCGGGTTGGCAGGTGTCCCAGCTTTGCTGTTGGGCAGGGACTTCTGCACTCCGTCCACAGTAGCCTTTGTCAGGTACCTCCCAGAGGAGGCCTTCCTGATTGCTAGCAAGTCTTTGAGCTGCAGC
TCGAATGGGCCGTCGGGGGACCCTGGAAGGATTAAGCAGCTTTTTTGAAAATGTTAATACATTACTCTGCTAATATGCTGACCTGCACTAATGCACCCTTGTGAGGACCCTCCGGGGCGAGGCCTCTG
ACACACCCTTCTCCCTGCCCTGAGCCCTGGAGGCAGCAGTGGGAGGGCAGCCTGCATACCTGGTTTTATGACTTTCAACCTCAGGTGAGGCAGGCTCTGGAAGCCAACTGCACAGTGTTGTGGGAAGT
TGAAGCATTACAGACTGGGCCAGGCTGCCTGTCCTCTGGTTCTGCTCTGGGCTCACAGGTTCATGGTGTAGCTGGCCCACTTGTCTTTCCCGGATGGCTTCTGGAGGAACATACCTGTAGATGCTTCC
TTCCTTTCCTTCAGAGACTGTGACAGAGAGAGTTTGTCAGCCAGAAGTGGCCACCAGGAGTAGTGGTTTATAAGAAATTACTGTCTCTTCAGTGAACTTCCTAGTTTCTTTATAGACTTAACCTTCCC
TTCAGTTAAAAGGTTTCTTTTATGAAGGGTCAAGACTGCTGACCTTGTGGGACCAGAGTTCTAAAGATGGAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NR_174157

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,653,347 - 158,665,751 (-)	NCBI
mRatBN7.2	5	153,370,338 - 153,382,743 (-)	NCBI

RefSeq Acc Id:

NR_174158

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,653,347 - 158,665,751 (-)	NCBI
mRatBN7.2	5	153,370,338 - 153,382,743 (-)	NCBI

RefSeq Acc Id:

NR_174159

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,653,347 - 158,665,751 (-)	NCBI
mRatBN7.2	5	153,370,338 - 153,382,743 (-)	NCBI

RefSeq Acc Id:

XM_006239180 ⟹ XP_006239242

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,657,091 - 158,665,761 (-)	NCBI
mRatBN7.2	5	153,374,081 - 153,382,753 (-)	NCBI
Rnor_6.0	5	159,593,593 - 159,602,260 (-)	NCBI
Rnor_5.0	5	163,302,181 - 163,314,578 (-)	NCBI

Sequence:

show sequence

TCCGGTCCTGAAGGGGCGGGGAAGAAGCCGGAAGTCCCGAGAGCTCCGGCGGTAGAGATGGAGGAGAGCGAGTACGAGTCTGTTCTCTGTGTCAAGCCAGAGGTCCATGTCTACCGCATCCCGCCGCG
GGCCACCAACCGTGGTTACAGGGCCTCAGAATGGCAACTGGACCAGCCATCCTGGAGTGGCCGGCTGCGGATCACTGCGAAAGGGAAGGTGGCCTACATCAAGCTGGAGGACAGGACCTCTGGGGAGC
TCTTTGCGCAGGCCCCAGTGGACCAGTTTCCCGGCACCGCTGTGGAGAGTGTGACAGACTCCAGCAGGTACTTCGTTATCCGAATTGAAGATGGAAACGGGCGACGTGCTTTTATTGGGATTGGCTTT
GGGGACCGAGGGGACGCCTTTGACTTCAACGTGGCATTGCAGGACCATTTCAAGTGGGTGAAGCAGCAGTGCGAGTTTGCAAAACAAGCTCAGAACCCAGATGAAGGCCCCAAGTTGGACCTGGGCTT
CAAGGAGGGCCAGACCATCAAGATCAACATCGCATTGGCCAGCTGGCCCTTGAGAGAAAATGCAAGTCCAATCCAGTGGACTGGTGGCACTGTGATTCTTTCTCTTGCTTGGAAGAAACTAACATTTA
CTGAGCGTCAGCTGTGGGCCAGGTCAGGAAGTAGAAGACTGATCCCTTTGGGAACGCCTTTCCTGCCCTGACTCCAGTGCCCTGGATTGGGTCTGTGCCTCGTTTCTGTGAGTTGTGGGAGACTAACT
CACTTTGACACACGATCCCCTTATTCACATCGTGCCGTAAGAGTTACCCATGTTGCTTCCTGTGGTTGTTCACCCTCTGTGATGGCCCCTGCCATTATGCCTGTGCTCCCGGTTCATCTGTTTCACTG
AGGATGGATGTTGGGGGTACTCCCTCTTGCGTCAGCTCCAGACACTGCTGCTGTGAATGGCCAAGCACATGTCTTTGTTGCTCACAGGATGGGGCTGCAGAATCCTGTGCTGCGCTGCACTGCGGATG
TCCTTGGATGCTTTGGCAGAGCCCTCTGAGAGCTTCCCTTGCCTCACATGCATGATGCTCTGTCTACCCTGTCCTTGTCAGCACTCCCAGTCGGGTTGTGTGTGTGGGATGGAATGGAGTAGGGCTGC
AATCTGGTGGCTACCTTCCTGGTGAGAAGTGAGATTAGGCGCTGGCTCTAACGCTGACCGTCTTGGTGCTAGATGGGAAATGGGGCGGCCTGGCTCTAGCCCATGCTGCTGCTGTTTGGGACCGTCAT
TTACTGTGCAGATGTTGGGGACTGGAGGTCCCCATGGGTTTCCAGTGCAGCTGACTCTGGCATGGTGGCTGACTTTCATTTTTCTCTTCC

hide sequence

RefSeq Acc Id:

XM_063287473 ⟹ XP_063143543

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,653,352 - 158,665,761 (-)	NCBI


Protein RefSeqs	NP_001386016	(Get FASTA)	NCBI Sequence Viewer
	NP_001386017	(Get FASTA)	NCBI Sequence Viewer
	NP_001386018	(Get FASTA)	NCBI Sequence Viewer
	NP_001386019	(Get FASTA)	NCBI Sequence Viewer
	NP_954527	(Get FASTA)	NCBI Sequence Viewer
	XP_006239242	(Get FASTA)	NCBI Sequence Viewer
	XP_063143543	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61826	(Get FASTA)	NCBI Sequence Viewer
	EDL80961	(Get FASTA)	NCBI Sequence Viewer
	EDL80962	(Get FASTA)	NCBI Sequence Viewer
	EDL80963	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011394
	ENSRNOP00000085569
	ENSRNOP00000095787
	ENSRNOP00000095787.1
	ENSRNOP00000103891
GenBank Protein	Q6P756	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_954527 ⟸ NM_199096
- Peptide Label:	isoform 4
- UniProtKB:	A6ITR1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSTASRRGPPTVVTGPQNGNWTSHPGVAGCGSLRKGRWPTSSWRTGPLAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDEGPKLDL GFKEGQTIKINIANMRKKEGAAGAPRTRPASAGGLSLLPPPPGGKMSTLIPPSGEQLSGGSLVQPVSGSGGATELWPQSKPAAAATADIWGDFTKSTGSPSSQSQPGTGWVQF hide sequence

RefSeq Acc Id:

XP_006239242 ⟸ XM_006239180

- Peptide Label:

isoform X1

- Sequence:

show sequence

MEESEYESVLCVKPEVHVYRIPPRATNRGYRASEWQLDQPSWSGRLRITAKGKVAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKW
VKQQCEFAKQAQNPDEGPKLDLGFKEGQTIKINIALASWPLRENASPIQWTGGTVILSLAWKKLTFTERQLWARSGSRRLIPLGTPFLP

hide sequence

Ensembl Acc Id:

ENSRNOP00000011394 ⟸ ENSRNOT00000011394

Ensembl Acc Id:

ENSRNOP00000085569 ⟸ ENSRNOT00000108752

Ensembl Acc Id:

ENSRNOP00000083128 ⟸ ENSRNOT00000108679

Protein Domains

NECAP PHear

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6P756-F1-model_v2	AlphaFold	Q6P756	1-263	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694217

Promoter ID:

EPDNEW_R4742

Type:

multiple initiation site

Name:

Necap2_1

Description:

NECAP endocytosis associated 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	159,602,222 - 159,602,282	EPDNEW

RGD ID:

13694225

Promoter ID:

EPDNEW_R4743

Type:

multiple initiation site

Name:

AC141489_1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	159,606,646 - 159,606,706	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-39368	BioCyc
Ensembl Genes	ENSRNOG00000008427	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000011394	ENTREZGENE
	ENSRNOT00000100304	ENTREZGENE
	ENSRNOT00000100304.1	UniProtKB/Swiss-Prot
	ENSRNOT00000108752	ENTREZGENE
	ENSRNOT00000142048	ENTREZGENE
Gene3D-CATH	2.30.29.30	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5599028	IMAGE-MGC_LOAD
InterPro	NECAP_PHear	UniProtKB/Swiss-Prot
	PH-like_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:298598	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72598	IMAGE-MGC_LOAD
NCBI Gene	298598	ENTREZGENE
PANTHER	ADAPTIN EAR-BINDING COAT-ASSOCIATED PROTEIN 2	UniProtKB/Swiss-Prot
	ATP-BINDING CASSETTE ABC TRANSPORTER-RELATED	UniProtKB/Swiss-Prot
Pfam	DUF1681	UniProtKB/Swiss-Prot
PhenoGen	Necap2	PhenoGen
RatGTEx	ENSRNOG00000008427	RatGTEx
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZWA4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A1Y0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2UIC7	ENTREZGENE, UniProtKB/TrEMBL
	A6ITR0	ENTREZGENE, UniProtKB/TrEMBL
	A6ITR1	ENTREZGENE, UniProtKB/TrEMBL
	A6ITR2_RAT	UniProtKB/TrEMBL
	NECP2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Necap2	NECAP endocytosis associated 2	MGC72598	Unknown (protein for MGC:72598)	Symbol and Name updated	1299863	APPROVED
2005-09-30	MGC72598				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar