Symbol:
Eif3c
Name:
eukaryotic translation initiation factor 3, subunit C
RGD ID:
1308871
Description:
Predicted to enable ribosome binding activity and translation initiation factor binding activity. Predicted to contribute to translation initiation factor activity. Predicted to be involved in positive regulation of translation and translational initiation. Predicted to be part of eukaryotic translation initiation factor 3 complex, eIF3m. Orthologous to several human genes including EIF3C (eukaryotic translation initiation factor 3 subunit C); PARTICIPATES IN translation initiation pathway; RNA transport pathway; INTERACTS WITH (+)-schisandrin B; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
eIF3 p110; Eif3s8; eukaryotic translation initiation factor 3 subunit 8; eukaryotic translation initiation factor 3 subunit C; eukaryotic translation initiation factor 3, subunit 8, 110kDa; LOC293484
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EIF3C (eukaryotic translation initiation factor 3 subunit C) HGNC
Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Eif3c (eukaryotic translation initiation factor 3, subunit C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
EIF3CL (eukaryotic translation initiation factor 3 subunit C like) HGNC
EggNOG, Ensembl, OrthoDB, Panther, PhylomeDB, Treefam
Homo sapiens (human):
TNS4 (tensin 4) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
EIF3C (eukaryotic translation initiation factor 3 subunit C)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Eif3c (eukaryotic translation initiation factor 3, subunit C)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
EIF3CL (eukaryotic translation initiation factor 3 subunit C like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
eif3c (eukaryotic translation initiation factor 3, subunit C)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
NIP1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
eIF3c
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
eif-3.C
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
eif3c
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,565,183 - 190,583,067 (-) NCBI GRCr8 mRatBN7.2 1 181,134,604 - 181,152,489 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 181,134,604 - 181,152,493 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,472,526 - 189,490,431 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,658,611 - 196,676,516 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 189,339,162 - 189,357,053 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 197,964,406 - 197,982,917 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 197,964,407 - 197,982,601 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 204,943,166 - 204,961,459 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 185,691,630 - 185,709,514 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 185,841,510 - 185,859,476 (-) NCBI Celera 1 178,792,634 - 178,810,513 (-) NCBI Celera Cytogenetic Map 1 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Eif3c Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of EIF3C mRNA] CTD PMID:31150632 Eif3c Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression EXP 6480464 o and p'-DDT affects the expression of EIF3C mRNA CTD PMID:17984292 Eif3c Rat 1,2-dimethylhydrazine affects expression ISO Eif3c (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of EIF3C mRNA CTD PMID:22206623 Eif3c Rat 1,2-dimethylhydrazine multiple interactions ISO Eif3c (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of EIF3C mRNA CTD PMID:22206623 Eif3c Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of EIF3C protein CTD PMID:32145629 Eif3c Rat 17beta-estradiol increases expression ISO Eif3c (Mus musculus) 6480464 Estradiol results in increased expression of EIF3C mRNA CTD PMID:39298647 Eif3c Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Eif3c (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EIF3C mRNA CTD PMID:21570461 and PMID:26377647 Eif3c Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of EIF3C mRNA CTD PMID:21346803 Eif3c Rat 3H-1,2-dithiole-3-thione increases expression ISO Eif3c (Mus musculus) 6480464 1 and 2-dithiol-3-thione results in increased expression of EIF3C mRNA CTD PMID:15375163 Eif3c Rat 4,4'-sulfonyldiphenol increases expression ISO Eif3c (Mus musculus) 6480464 bisphenol S results in increased expression of EIF3C mRNA CTD PMID:39298647 Eif3c Rat 4,4'-sulfonyldiphenol increases expression ISO EIF3C (Homo sapiens) 6480464 bisphenol S results in increased expression of EIF3C protein CTD PMID:34186270 Eif3c Rat 4,4'-sulfonyldiphenol affects methylation ISO Eif3c (Mus musculus) 6480464 bisphenol S affects the methylation of EIF3C gene CTD PMID:31683443 Eif3c Rat 4-vinylcyclohexene dioxide affects expression ISO Eif3c (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of EIF3C mRNA CTD PMID:20829426 Eif3c Rat acrolein multiple interactions ISO EIF3C (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of EIF3C mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of EIF3C mRNA CTD PMID:32699268 Eif3c Rat aflatoxin B1 increases expression ISO Eif3c (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of EIF3C mRNA CTD PMID:19770486 Eif3c Rat all-trans-retinoic acid decreases expression ISO EIF3C (Homo sapiens) 6480464 Tretinoin results in decreased expression of EIF3C mRNA CTD PMID:16140955 Eif3c Rat all-trans-retinoic acid multiple interactions ISO EIF3C (Homo sapiens) 6480464 Thiophenes analog promotes the reaction [Tretinoin results in decreased expression of EIF3C mRNA] CTD PMID:16140955 Eif3c Rat alpha-pinene multiple interactions ISO EIF3C (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of EIF3C mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of EIF3C mRNA CTD PMID:32699268 Eif3c Rat Aroclor 1254 decreases expression ISO Eif3c (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of EIF3C mRNA CTD PMID:23650126 Eif3c Rat arsenous acid increases expression ISO EIF3C (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of EIF3C mRNA CTD PMID:20458559 Eif3c Rat benzatropine multiple interactions ISO EIF3C (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of EIF3C protein CTD PMID:34122009 Eif3c Rat benzo[a]pyrene decreases expression ISO Eif3c (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of EIF3C mRNA CTD PMID:21715664 Eif3c Rat benzo[a]pyrene increases expression ISO Eif3c (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of EIF3C mRNA CTD PMID:19770486 Eif3c Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of EIF3C mRNA CTD PMID:17630414 Eif3c Rat bis(2-ethylhexyl) phthalate decreases expression ISO EIF3C (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of EIF3C mRNA CTD PMID:28412506 Eif3c Rat bis(2-ethylhexyl) phthalate decreases expression ISO Eif3c (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of EIF3C mRNA CTD PMID:33754040 Eif3c Rat bisphenol A increases expression ISO Eif3c (Mus musculus) 6480464 bisphenol A results in increased expression of EIF3C mRNA CTD PMID:21932408 and PMID:26063408 Eif3c Rat bisphenol A increases expression ISO EIF3C (Homo sapiens) 6480464 bisphenol A results in increased expression of EIF3C mRNA CTD PMID:36232920 Eif3c Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of EIF3C mRNA CTD PMID:33296240 Eif3c Rat bisphenol A affects expression ISO EIF3C (Homo sapiens) 6480464 bisphenol A affects the expression of EIF3C mRNA CTD PMID:30903817 Eif3c Rat bisphenol A increases methylation ISO Eif3c (Mus musculus) 6480464 bisphenol A results in increased methylation of EIF3C promoter CTD PMID:27312807 Eif3c Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of EIF3C gene CTD PMID:28505145 Eif3c Rat bisphenol AF increases expression ISO EIF3C (Homo sapiens) 6480464 bisphenol AF results in increased expression of EIF3C protein CTD PMID:34186270 Eif3c Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of EIF3C mRNA CTD PMID:12628495 Eif3c Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of EIF3C mRNA CTD PMID:24136188 Eif3c Rat caffeine affects phosphorylation ISO EIF3C (Homo sapiens) 6480464 Caffeine affects the phosphorylation of EIF3C protein CTD PMID:35688186 Eif3c Rat carbamazepine affects expression ISO EIF3C (Homo sapiens) 6480464 Carbamazepine affects the expression of EIF3C mRNA CTD PMID:24752500 Eif3c Rat carbon nanotube decreases expression ISO Eif3c (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of EIF3C mRNA CTD PMID:25554681 Eif3c Rat CGP 52608 multiple interactions ISO EIF3C (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to EIF3C gene] CTD PMID:28238834 Eif3c Rat chloroacetaldehyde decreases expression ISO EIF3C (Homo sapiens) 6480464 chloroacetaldehyde results in decreased expression of EIF3C mRNA CTD PMID:25596134 Eif3c Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of EIF3C mRNA CTD PMID:23125180 Eif3c Rat chlorpyrifos decreases expression ISO Eif3c (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of EIF3C mRNA CTD PMID:37019170 Eif3c Rat choline multiple interactions ISO Eif3c (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of EIF3C mRNA CTD PMID:20938992 Eif3c Rat chromium(6+) affects expression ISO Eif3c (Mus musculus) 6480464 chromium hexavalent ion affects the expression of EIF3C mRNA CTD PMID:28472532 Eif3c Rat cidofovir anhydrous decreases expression ISO EIF3C (Homo sapiens) 6480464 Cidofovir results in decreased expression of EIF3C mRNA CTD PMID:25596134 Eif3c Rat cisplatin decreases expression ISO EIF3C (Homo sapiens) 6480464 Cisplatin results in decreased expression of EIF3C mRNA CTD PMID:25596134 Eif3c Rat clodronic acid decreases expression ISO EIF3C (Homo sapiens) 6480464 Clodronic Acid results in decreased expression of EIF3C mRNA CTD PMID:25596134 Eif3c Rat clofibrate decreases expression ISO Eif3c (Mus musculus) 6480464 Clofibrate results in decreased expression of EIF3C mRNA CTD PMID:17585979 Eif3c Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of EIF3C mRNA CTD PMID:17602206 Eif3c Rat clozapine multiple interactions ISO EIF3C (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in decreased expression of EIF3C protein CTD PMID:34122009 Eif3c Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of EIF3C mRNA CTD PMID:17898221 Eif3c Rat coumarin increases phosphorylation ISO EIF3C (Homo sapiens) 6480464 coumarin results in increased phosphorylation of EIF3C protein CTD PMID:35688186 Eif3c Rat Cuprizon multiple interactions ISO EIF3C (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of EIF3C protein and [Cuprizone co-treated with Clozapine] results in decreased expression of EIF3C protein CTD PMID:34122009 Eif3c Rat cyclosporin A decreases expression ISO EIF3C (Homo sapiens) 6480464 Cyclosporine results in decreased expression of EIF3C mRNA CTD PMID:22147139 Eif3c Rat cyclosporin A increases methylation ISO EIF3C (Homo sapiens) 6480464 Cyclosporine results in increased methylation of EIF3C promoter CTD PMID:27989131 Eif3c Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of EIF3C mRNA CTD PMID:25596134 Eif3c Rat cyclosporin A increases expression ISO Eif3c (Mus musculus) 6480464 Cyclosporine results in increased expression of EIF3C mRNA CTD PMID:19770486 Eif3c Rat deoxynivalenol affects phosphorylation ISO Eif3c (Mus musculus) 6480464 deoxynivalenol affects the phosphorylation of EIF3C protein CTD PMID:23811945 Eif3c Rat diarsenic trioxide increases expression ISO EIF3C (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of EIF3C mRNA CTD PMID:20458559 Eif3c Rat dibutyl phthalate decreases expression ISO Eif3c (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of EIF3C mRNA CTD PMID:17361019 Eif3c Rat diclofenac affects expression ISO EIF3C (Homo sapiens) 6480464 Diclofenac affects the expression of EIF3C mRNA CTD PMID:24752500 Eif3c Rat dioxygen decreases expression ISO EIF3C (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of EIF3C mRNA CTD PMID:25596134 Eif3c Rat doxorubicin increases expression ISO EIF3C (Homo sapiens) 6480464 Doxorubicin results in increased expression of EIF3C mRNA CTD PMID:29803840 Eif3c Rat elemental selenium increases expression ISO EIF3C (Homo sapiens) 6480464 Selenium results in increased expression of EIF3C mRNA CTD PMID:19244175 Eif3c Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of EIF3C mRNA CTD PMID:25596134 Eif3c Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of EIF3C mRNA CTD PMID:24136188 Eif3c Rat folic acid multiple interactions ISO Eif3c (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Eif3c Rat glyphosate decreases expression ISO Eif3c (Mus musculus) 6480464 Glyphosate results in decreased expression of EIF3C protein CTD PMID:37208198 Eif3c Rat ifosfamide decreases expression ISO EIF3C (Homo sapiens) 6480464 Ifosfamide results in decreased expression of EIF3C mRNA CTD PMID:25596134 Eif3c Rat indoles increases expression EXP 6480464 Indoles results in increased expression of EIF3C mRNA CTD PMID:20521778 Eif3c Rat indoles decreases expression EXP 6480464 Indoles results in decreased expression of EIF3C mRNA CTD PMID:20521778 Eif3c Rat isoflavones decreases expression ISO EIF3C (Homo sapiens) 6480464 Isoflavones results in decreased expression of EIF3C mRNA CTD PMID:17374662 Eif3c Rat ivermectin decreases expression ISO EIF3C (Homo sapiens) 6480464 Ivermectin results in decreased expression of EIF3C protein CTD PMID:32959892 Eif3c Rat L-ascorbic acid decreases expression ISO EIF3C (Homo sapiens) 6480464 Ascorbic Acid results in decreased expression of EIF3C mRNA CTD PMID:19197388 Eif3c Rat L-methionine multiple interactions ISO Eif3c (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of EIF3C mRNA CTD PMID:20938992 Eif3c Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of EIF3CL mRNA CTD PMID:11578147 Eif3c Rat menadione affects expression ISO EIF3C (Homo sapiens) 6480464 Vitamin K 3 affects the expression of EIF3C mRNA CTD PMID:20044591 Eif3c Rat metformin increases expression EXP 6480464 Metformin results in increased expression of EIF3C mRNA CTD PMID:25596134 Eif3c Rat methidathion increases expression ISO Eif3c (Mus musculus) 6480464 methidathion results in increased expression of EIF3C mRNA CTD PMID:34813904 Eif3c Rat miconazole increases expression ISO Eif3c (Mus musculus) 6480464 Miconazole results in increased expression of EIF3C mRNA CTD PMID:27462272 Eif3c Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of EIF3C mRNA CTD PMID:17602206 Eif3c Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of EIF3C mRNA CTD PMID:24136188 Eif3c Rat ozone multiple interactions ISO EIF3C (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of EIF3C mRNA more ... CTD PMID:32699268 Eif3c Rat paracetamol affects expression ISO Eif3c (Mus musculus) 6480464 Acetaminophen affects the expression of EIF3C mRNA CTD PMID:17562736 Eif3c Rat phenobarbital decreases expression ISO Eif3c (Mus musculus) 6480464 Phenobarbital results in decreased expression of EIF3C mRNA CTD PMID:23091169 Eif3c Rat picoxystrobin decreases expression ISO EIF3C (Homo sapiens) 6480464 picoxystrobin results in decreased expression of EIF3C mRNA CTD PMID:33512557 Eif3c Rat pirinixic acid increases expression ISO Eif3c (Mus musculus) 6480464 pirinixic acid results in increased expression of EIF3C mRNA CTD PMID:18445702 and PMID:23811191 Eif3c Rat propiconazole increases expression ISO Eif3c (Mus musculus) 6480464 propiconazole results in increased expression of EIF3C mRNA CTD PMID:21278054 Eif3c Rat rotenone decreases expression ISO EIF3C (Homo sapiens) 6480464 Rotenone results in decreased expression of EIF3C mRNA CTD PMID:33512557 Eif3c Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of EIF3C protein CTD PMID:35544339 Eif3c Rat selenium atom increases expression ISO EIF3C (Homo sapiens) 6480464 Selenium results in increased expression of EIF3C mRNA CTD PMID:19244175 Eif3c Rat sodium arsenite increases stability ISO EIF3C (Homo sapiens) 6480464 sodium arsenite results in increased stability of EIF3C mRNA CTD PMID:25493608 Eif3c Rat sodium arsenite increases expression ISO Eif3c (Mus musculus) 6480464 sodium arsenite results in increased expression of EIF3C mRNA CTD PMID:32068019 Eif3c Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of EIF3C mRNA CTD PMID:31150632 Eif3c Rat tetrachloromethane increases expression ISO Eif3c (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of EIF3C mRNA CTD PMID:31919559 Eif3c Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of EIF3C mRNA] CTD PMID:31150632 Eif3c Rat thiophenes multiple interactions ISO EIF3C (Homo sapiens) 6480464 Thiophenes analog promotes the reaction [Tretinoin results in decreased expression of EIF3C mRNA] CTD PMID:16140955 Eif3c Rat titanium dioxide decreases methylation ISO Eif3c (Mus musculus) 6480464 titanium dioxide results in decreased methylation of EIF3C gene and titanium dioxide results in decreased methylation of EIF3C promoter CTD PMID:35295148 Eif3c Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of EIF3C gene CTD PMID:27618143 Eif3c Rat trimellitic anhydride increases expression ISO Eif3c (Mus musculus) 6480464 trimellitic anhydride results in increased expression of EIF3C mRNA CTD PMID:19042947 Eif3c Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of EIF3C mRNA CTD PMID:25596134 Eif3c Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of EIF3C mRNA CTD PMID:24136188 Eif3c Rat tungsten decreases expression ISO Eif3c (Mus musculus) 6480464 Tungsten results in decreased expression of EIF3C mRNA CTD PMID:30912803 Eif3c Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of EIF3C mRNA CTD PMID:23034163 Eif3c Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of EIF3C mRNA CTD PMID:19111725 Eif3c Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of EIF3C mRNA CTD PMID:19111725
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dinitrotoluene (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) 4-vinylcyclohexene dioxide (ISO) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) Aroclor 1254 (ISO) arsenous acid (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bromobenzene (EXP) buspirone (EXP) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroacetaldehyde (ISO) chloroprene (EXP) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clodronic acid (ISO) clofibrate (ISO) clofibric acid (EXP) clozapine (ISO) cocaine (EXP) coumarin (ISO) Cuprizon (ISO) cyclosporin A (EXP,ISO) deoxynivalenol (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diclofenac (ISO) dioxygen (ISO) doxorubicin (ISO) elemental selenium (ISO) fenofibrate (EXP) flutamide (EXP) folic acid (ISO) glyphosate (ISO) ifosfamide (ISO) indoles (EXP) isoflavones (ISO) ivermectin (ISO) L-ascorbic acid (ISO) L-methionine (ISO) lead diacetate (EXP) menadione (ISO) metformin (EXP) methidathion (ISO) miconazole (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) ozone (ISO) paracetamol (ISO) phenobarbital (ISO) picoxystrobin (ISO) pirinixic acid (ISO) propiconazole (ISO) rotenone (EXP,ISO) selenium atom (ISO) sodium arsenite (ISO) tetrachloromethane (EXP,ISO) thiophenes (ISO) titanium dioxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) troglitazone (EXP) trovafloxacin (EXP) tungsten (ISO) vinclozolin (EXP) zinc atom (EXP) zinc(0) (EXP)
Eif3c Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 190,565,183 - 190,583,067 (-) NCBI GRCr8 mRatBN7.2 1 181,134,604 - 181,152,489 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 181,134,604 - 181,152,493 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 189,472,526 - 189,490,431 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 196,658,611 - 196,676,516 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 189,339,162 - 189,357,053 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 197,964,406 - 197,982,917 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 197,964,407 - 197,982,601 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 204,943,166 - 204,961,459 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 185,691,630 - 185,709,514 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 185,841,510 - 185,859,476 (-) NCBI Celera 1 178,792,634 - 178,810,513 (-) NCBI Celera Cytogenetic Map 1 q36 NCBI
EIF3C Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 28,688,558 - 28,735,730 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 28,688,558 - 28,735,727 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 28,699,879 - 28,747,051 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 28,630,283 - 28,654,552 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 28,630,284 - 28,654,535 NCBI Celera 16 28,059,155 - 28,083,432 (-) NCBI Celera Cytogenetic Map 16 p11.2 NCBI HuRef 16 26,681,316 - 26,681,588 (+) NCBI HuRef CHM1_1 16 29,711,601 - 29,758,789 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 28,969,279 - 29,016,311 (+) NCBI T2T-CHM13v2.0
Eif3c Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 126,146,083 - 126,165,538 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 126,145,627 - 126,165,583 (-) Ensembl GRCm39 Ensembl GRCm38 7 126,546,911 - 126,566,366 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 126,546,455 - 126,566,411 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 133,690,425 - 133,709,880 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 126,338,059 - 126,357,514 (-) NCBI MGSCv36 mm8 Celera 7 126,399,287 - 126,416,135 (-) NCBI Celera Cytogenetic Map 7 F3 NCBI cM Map 7 69.14 NCBI
.
Predicted Target Of
Count of predictions: 87 Count of miRNA genes: 69 Interacting mature miRNAs: 69 Transcripts: ENSRNOT00000025782 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 61326 Eae6 Experimental allergic encephalomyelitis QTL 6 5.3 body mass (VT:0001259) change in body weight (CMO:0002045) 1 172949660 181830018 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat 2325725 Eae31 Experimental allergic encephalomyelitis QTL 31 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 1 178810256 188377506 Rat 631670 Iddm10 Insulin dependent diabetes mellitus QTL 10 1.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 174133260 196383668 Rat
RH128351
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 190,565,190 - 190,565,491 (+) Marker Load Pipeline mRatBN7.2 1 181,134,611 - 181,134,912 (+) MAPPER mRatBN7.2 Rnor_6.0 1 197,964,414 - 197,964,714 NCBI Rnor6.0 Rnor_5.0 1 204,943,174 - 204,943,474 UniSTS Rnor5.0 RGSC_v3.4 1 185,691,638 - 185,691,938 UniSTS RGSC3.4 Celera 1 178,792,642 - 178,792,942 UniSTS Cytogenetic Map 1 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025782 ⟹ ENSRNOP00000025782
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 181,134,608 - 181,152,493 (-) Ensembl Rnor_6.0 Ensembl 1 197,964,407 - 197,982,601 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110715 ⟹ ENSRNOP00000087308
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 181,134,608 - 181,152,493 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118052 ⟹ ENSRNOP00000080978
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 181,134,604 - 181,151,223 (-) Ensembl
RefSeq Acc Id:
NM_001100662 ⟹ NP_001094132
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 190,565,183 - 190,583,067 (-) NCBI mRatBN7.2 1 181,134,604 - 181,152,489 (-) NCBI Rnor_6.0 1 197,964,406 - 197,982,601 (-) NCBI Rnor_5.0 1 204,943,166 - 204,961,459 (-) NCBI RGSC_v3.4 1 185,691,630 - 185,709,514 (-) RGD Celera 1 178,792,634 - 178,810,513 (-) RGD
Sequence:
CTCGGCTTTCGGGGGGATCTCGCTCGGCTTTCGGGCCGATCTGCTCGGTTTTCGGGCGGATCTGCTCGGCTTTCGGGCGGATCTCGCCTTTCGGGCCGCCGGCTCGGCTTTCGGGCCCGTCTCGGCCG
hide sequence
RefSeq Acc Id:
NP_001094132 ⟸ NM_001100662
- UniProtKB:
Q3MIB2 (UniProtKB/Swiss-Prot), B5DFC8 (UniProtKB/Swiss-Prot), A0A8I6G7D4 (UniProtKB/TrEMBL)
- Sequence:
MSRFFTTGSDSESESSLSGEELVTKPVSGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYVRILADLEDYLNELWEDKEGKK
hide sequence
Ensembl Acc Id:
ENSRNOP00000025782 ⟸ ENSRNOT00000025782
Ensembl Acc Id:
ENSRNOP00000080978 ⟸ ENSRNOT00000118052
Ensembl Acc Id:
ENSRNOP00000087308 ⟸ ENSRNOT00000110715
RGD ID: 13690402 Promoter ID: EPDNEW_R925 Type: initiation region Name: Eif3c_1 Description: eukaryotic translation initiation factor 3, subunit C SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 197,982,637 - 197,982,697 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Eif3c
eukaryotic translation initiation factor 3, subunit C
Eif3s8
eukaryotic translation initiation factor 3, subunit 8, 110kDa
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Eif3s8
eukaryotic translation initiation factor 3, subunit 8, 110kDa
Eif3s8_predicted
eukaryotic translation initiation factor 3, subunit 8, 110kDa (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Eif3s8_predicted
eukaryotic translation initiation factor 3, subunit 8, 110kDa (predicted)
Symbol and Name status set to approved
70820 APPROVED
