Advanced Search (OLGA)

Gene: Get3 (guided entry of tail-anchored proteins factor 3, ATPase) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Get3

Name:

guided entry of tail-anchored proteins factor 3, ATPase

RGD ID:

1307906

Description:

Predicted to enable ATP hydrolysis activity and membrane insertase activity. Involved in tail-anchored membrane protein insertion into ER membrane. Part of GET complex. Human ortholog(s) of this gene implicated in dilated cardiomyopathy. Orthologous to human GET3 (guided entry of tail-anchored proteins factor 3, ATPase); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

arsA arsenite transporter, ATP-binding, homolog 1; arsA arsenite transporter, ATP-binding, homolog 1 (bacterial); arsenical pump-driving ATPase; arsenite-stimulated ATPase; Asna1; ATPase ASNA1; ATPase GET3; LOC288919

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,034,675 - 40,043,064 (+)	NCBI		GRCr8
mRatBN7.2	19	23,130,109 - 23,138,196 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,130,109 - 23,138,193 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	29,952,705 - 29,960,802 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,607,069 - 30,615,165 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	32,829,753 - 32,837,848 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	26,133,024 - 26,142,637 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	26,133,027 - 26,141,111 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	37,108,647 - 37,116,734 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	24,786,390 - 24,794,477 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	24,791,225 - 24,799,303 (+)	NCBI
Celera	19	22,688,066 - 22,696,153 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Get3	Rat	Aicardi-Goutieres Syndrome 4		ISO	GET3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aicardi-Goutieres syndrome 4	ClinVar	PMID:10371528 more ...
Get3	Rat	alpha-mannosidosis		ISO	GET3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deficiency of alpha-mannosidase	ClinVar	PMID:28492532
Get3	Rat	Charcot-Marie-Tooth disease dominant intermediate B		ISO	GET3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease dominant intermediate B	ClinVar	PMID:28492532
Get3	Rat	Dilated Cardiomyopathy 2H		ISO	GET3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cardiomyopathy more ...	ClinVar	PMID:31461301
Get3	Rat	episodic ataxia type 2		ISO	GET3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Episodic ataxia type 2	ClinVar	PMID:10371528 more ...
Get3	Rat	glutaric acidemia I		ISO	GET3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glutaric aciduria and type 1	ClinVar	PMID:10371528 more ...
Get3	Rat	prostate cancer		ISO	GET3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Malignant tumor of prostate	ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Get3	Rat	Dilated Cardiomyopathy 2H		ISO	GET3 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Get3	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Get3 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ASNA1 mRNA	CTD	PMID:36331819
Get3	Rat	1,2-dimethylhydrazine	increases expression	ISO	Get3 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of GET3 mRNA	CTD	PMID:22206623
Get3	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Get3 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GET3 mRNA	CTD	PMID:17942748
Get3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Get3 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of GET3 mRNA	CTD	PMID:24680724
Get3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of GET3 mRNA	CTD	PMID:33387578
Get3	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Get3 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GET3 mRNA	CTD	PMID:17942748
Get3	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	Get3 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of GET3 mRNA	CTD	PMID:20188158
Get3	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Get3 (Mus musculus)	6480464	bisphenol S results in increased expression of GET3 mRNA	CTD	PMID:39298647
Get3	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GET3 mRNA	CTD	PMID:36041667
Get3	Rat	7,12-dimethyltetraphene	decreases expression	ISO	Get3 (Mus musculus)	6480464	9 more ...	CTD	PMID:38307155
Get3	Rat	acrolein	multiple interactions	ISO	GET3 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of GET3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of GET3 mRNA	CTD	PMID:32699268
Get3	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of GET3 mRNA	CTD	PMID:28959563
Get3	Rat	actinomycin D	multiple interactions	ISO	GET3 (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of GET3 protein	CTD	PMID:38460933
Get3	Rat	aflatoxin B1	increases expression	ISO	GET3 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of GET3 mRNA	CTD	PMID:27153756
Get3	Rat	all-trans-retinoic acid	increases expression	ISO	GET3 (Homo sapiens)	6480464	Tretinoin results in increased expression of GET3 mRNA	CTD	PMID:16054129
Get3	Rat	alpha-pinene	multiple interactions	ISO	GET3 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of GET3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of GET3 mRNA	CTD	PMID:32699268
Get3	Rat	aristolochic acid A	increases expression	ISO	GET3 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of GET3 mRNA	CTD	PMID:33212167
Get3	Rat	arsenous acid	increases expression	ISO	GET3 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of GET3 mRNA and Arsenic Trioxide results in increased expression of GET3 protein	CTD	PMID:27736728
Get3	Rat	benzo[a]pyrene	affects methylation	ISO	GET3 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of GET3 promoter	CTD	PMID:27901495
Get3	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Get3 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of ASNA1 mRNA	CTD	PMID:33754040
Get3	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GET3 mRNA and [bisphenol A co-treated with tributyltin] results in increased expression of GET3 mRNA	CTD	PMID:31129395 and PMID:36041667
Get3	Rat	bisphenol A	increases expression	ISO	GET3 (Homo sapiens)	6480464	bisphenol A results in increased expression of GET3 protein	CTD	PMID:37567409
Get3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of GET3 mRNA	CTD	PMID:25181051 and PMID:34947998
Get3	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GET3 mRNA	CTD	PMID:36041667
Get3	Rat	carbon nanotube	increases expression	ISO	Get3 (Mus musculus)	6480464	Nanotubes and Carbon analog results in increased expression of GET3 mRNA	CTD	PMID:25554681
Get3	Rat	CGP 52608	multiple interactions	ISO	GET3 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to ASNA1 gene]	CTD	PMID:28238834
Get3	Rat	cisplatin	affects response to substance	ISO	GET3 (Homo sapiens)	6480464	GET3 protein affects the susceptibility to Cisplatin	CTD	PMID:20966125
Get3	Rat	clobetasol	increases expression	ISO	Get3 (Mus musculus)	6480464	Clobetasol results in increased expression of GET3 mRNA	CTD	PMID:27462272
Get3	Rat	clofibrate	decreases expression	ISO	Get3 (Mus musculus)	6480464	Clofibrate results in decreased expression of GET3 mRNA	CTD	PMID:17585979
Get3	Rat	crocidolite asbestos	increases expression	ISO	Get3 (Mus musculus)	6480464	Asbestos and Crocidolite results in increased expression of GET3 mRNA	CTD	PMID:19446018
Get3	Rat	diarsenic trioxide	increases expression	ISO	GET3 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of GET3 mRNA and Arsenic Trioxide results in increased expression of GET3 protein	CTD	PMID:27736728
Get3	Rat	dibutyl phthalate	decreases expression	ISO	Get3 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of GET3 mRNA	CTD	PMID:17361019 and PMID:21266533
Get3	Rat	doxorubicin	decreases expression	ISO	GET3 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of GET3 mRNA	CTD	PMID:29803840
Get3	Rat	ethanol	affects splicing	ISO	Get3 (Mus musculus)	6480464	Ethanol affects the splicing of GET3 mRNA	CTD	PMID:30319688
Get3	Rat	fenthion	increases expression	ISO	Get3 (Mus musculus)	6480464	Fenthion results in increased expression of GET3 mRNA	CTD	PMID:34813904
Get3	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of GET3 mRNA	CTD	PMID:24136188
Get3	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of GET3 mRNA	CTD	PMID:33387578
Get3	Rat	hydrogen cyanide	decreases expression	ISO	Get3 (Mus musculus)	6480464	Hydrogen Cyanide results in decreased expression of GET3 mRNA	CTD	PMID:33914522
Get3	Rat	hydroquinone O-beta-D-glucopyranoside	decreases expression	ISO	GET3 (Homo sapiens)	6480464	Arbutin results in decreased expression of GET3 mRNA	CTD	PMID:17103032
Get3	Rat	ivermectin	decreases expression	ISO	GET3 (Homo sapiens)	6480464	Ivermectin results in decreased expression of GET3 protein	CTD	PMID:32959892
Get3	Rat	lead(0)	decreases expression	ISO	GET3 (Homo sapiens)	6480464	Lead results in decreased expression of GET3 mRNA	CTD	PMID:19921347
Get3	Rat	methidathion	increases expression	ISO	Get3 (Mus musculus)	6480464	methidathion results in increased expression of GET3 mRNA	CTD	PMID:34813904
Get3	Rat	nitrofen	decreases expression	EXP		6480464	nitrofen results in decreased expression of GET3 mRNA	CTD	PMID:26720608
Get3	Rat	Nutlin-3	multiple interactions	ISO	GET3 (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of GET3 protein	CTD	PMID:38460933
Get3	Rat	ozone	multiple interactions	ISO	GET3 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of GET3 mRNA more ...	CTD	PMID:32699268
Get3	Rat	perfluorooctane-1-sulfonic acid	increases expression	ISO	GET3 (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in increased expression of GET3 mRNA	CTD	PMID:27153767
Get3	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Get3 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ASNA1 mRNA	CTD	PMID:36331819
Get3	Rat	perfluorooctanoic acid	increases expression	ISO	GET3 (Homo sapiens)	6480464	perfluorooctanoic acid results in increased expression of GET3 protein	CTD	PMID:22609092
Get3	Rat	pirinixic acid	multiple interactions	ISO	GET3 (Homo sapiens)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of GET3 mRNA	CTD	PMID:19710929
Get3	Rat	poly(I:C)	multiple interactions	EXP		6480464	[Poly I-C co-treated with HU 211] results in increased expression of GET3 mRNA	CTD	PMID:26923065
Get3	Rat	potassium cyanide	increases expression	ISO	Get3 (Mus musculus)	6480464	Potassium Cyanide results in increased expression of GET3 mRNA	CTD	PMID:33914522
Get3	Rat	sodium arsenate	increases expression	ISO	Get3 (Mus musculus)	6480464	sodium arsenate results in increased expression of GET3 mRNA	CTD	PMID:30953684
Get3	Rat	sodium arsenite	increases activity	ISO	GET3 (Homo sapiens)	6480464	sodium arsenite results in increased activity of GET3 protein	CTD	PMID:9712828
Get3	Rat	sodium arsenite	increases expression	ISO	GET3 (Homo sapiens)	6480464	sodium arsenite results in increased expression of GET3 mRNA	CTD	PMID:38568856
Get3	Rat	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of GET3 protein	CTD	PMID:29459688
Get3	Rat	thapsigargin	increases expression	EXP		6480464	Thapsigargin results in increased expression of GET3 protein	CTD	PMID:35544339
Get3	Rat	tributylstannane	multiple interactions	EXP		6480464	[bisphenol A co-treated with tributyltin] results in increased expression of GET3 mRNA	CTD	PMID:31129395
Get3	Rat	triphenyl phosphate	affects expression	ISO	GET3 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of ASNA1 mRNA	CTD	PMID:37042841
Get3	Rat	triptonide	increases expression	ISO	Get3 (Mus musculus)	6480464	triptonide results in increased expression of GET3 mRNA	CTD	PMID:33045310
Get3	Rat	valproic acid	increases expression	ISO	GET3 (Homo sapiens)	6480464	Valproic Acid results in increased expression of GET3 mRNA	CTD	PMID:23179753
Get3	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of GET3 mRNA	CTD	PMID:19015723

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Get3	Rat	protein insertion into ER membrane	involved_in	IEA	UniRule:UR000106709	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Get3	Rat	tail-anchored membrane protein insertion into ER membrane	involved_in	IDA		42721993	PMID:27226539	UniProt
Get3	Rat	tail-anchored membrane protein insertion into ER membrane	involved_in	IEA	UniProtKB:O43681 and ensembl:ENSP00000349887	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Get3	Rat	tail-anchored membrane protein insertion into ER membrane	involved_in	IBA	PANTHER:PTN000085952 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Get3	Rat	tail-anchored membrane protein insertion into ER membrane	involved_in	ISO	GET3 (Homo sapiens)	1624291	PMID:23041287 more ...	RGD	PMID:23041287 more ...
Get3	Rat	tail-anchored membrane protein insertion into ER membrane	involved_in	IDA		42721997	PMID:23041287	UniProt

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Get3	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Get3	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Get3	Rat	endoplasmic reticulum	located_in	IEA	UniRule:UR000106709	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Get3	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Get3	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-SubCell:SL-0095	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Get3	Rat	endoplasmic reticulum membrane	is_active_in	IEA	UniProtKB:O43681 and ensembl:ENSP00000349887	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Get3	Rat	endoplasmic reticulum membrane	is_active_in	ISO	GET3 (Homo sapiens)	1624291	PMID:32910895	RGD	PMID:32910895
Get3	Rat	GET complex	part_of	IPI	UniProtKB:Q6DGG9 and UniProtKB:Q6P6S5	42721997	PMID:23041287	UniProt
Get3	Rat	GET complex	part_of	IBA	PANTHER:PTN000085952 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Get3	Rat	GET complex	part_of	IEA	UniProtKB:O43681 and ensembl:ENSP00000349887	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Get3	Rat	GET complex	part_of	ISO	GET3 (Homo sapiens)	1624291	UniProtKB:O00258 more ...	RGD	PMID:23041287 and PMID:32910895
Get3	Rat	nucleolus	located_in	ISO	GET3 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Get3	Rat	nucleolus	located_in	IEA	UniProtKB:O43681 and ensembl:ENSP00000349887	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Get3	Rat	nucleolus	located_in	IEA	UniProtKB-SubCell:SL-0188	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Get3	Rat	nucleoplasm	located_in	IEA	UniProtKB:O43681 and ensembl:ENSP00000349887	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Get3	Rat	nucleoplasm	located_in	ISO	GET3 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Get3	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Get3	Rat	ATP binding	enables	IEA	UniRule:UR000106709	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Get3	Rat	ATP binding	enables	IEA	InterPro:IPR016300 and InterPro:IPR027542	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Get3	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Get3	Rat	ATP hydrolysis activity	enables	ISO	GET3 (Homo sapiens)	1624291	PMID:9712828	RGD	PMID:9712828
Get3	Rat	ATP hydrolysis activity	enables	IEA	UniProtKB:O43681 and ensembl:ENSP00000349887	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Get3	Rat	ATP hydrolysis activity	enables	IEA	InterPro:IPR016300 and InterPro:IPR027542	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Get3	Rat	ATP hydrolysis activity	enables	IBA	PANTHER:PTN000085951 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Get3	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Get3	Rat	membrane insertase activity	enables	ISO	GET3 (Homo sapiens)	1624291	PMID:23610396	RGD	PMID:23610396
Get3	Rat	membrane insertase activity	enables	IEA	UniProtKB:O43681 and ensembl:ENSP00000349887	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Get3	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Get3	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Get3	Rat	protein binding	enables	ISO	GET3 (Homo sapiens)	1624291	UniProtKB:O00264 more ...	RGD	PMID:21516116 more ...

#	Reference Title	Reference Citation
1.	Tail-anchored Protein Insertion in Mammals: FUNCTION AND RECIPROCAL INTERACTIONS OF THE TWO SUBUNITS OF THE TRC40 RECEPTOR.	Colombo SF, etal., J Biol Chem. 2016 Jul 15;291(29):15292-306. doi: 10.1074/jbc.M115.707752. Epub 2016 May 23.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Molecular machinery for insertion of tail-anchored membrane proteins into the endoplasmic reticulum membrane in mammalian cells.	Yamamoto Y and Sakisaka T, Mol Cell. 2012 Nov 9;48(3):387-97. doi: 10.1016/j.molcel.2012.08.028. Epub 2012 Oct 4.

PMID:8889548	PMID:12477932	PMID:19056867	PMID:23376485	PMID:25535373

Get3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,034,675 - 40,043,064 (+)	NCBI		GRCr8
mRatBN7.2	19	23,130,109 - 23,138,196 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,130,109 - 23,138,193 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	29,952,705 - 29,960,802 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,607,069 - 30,615,165 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	32,829,753 - 32,837,848 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	26,133,024 - 26,142,637 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	26,133,027 - 26,141,111 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	37,108,647 - 37,116,734 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	24,786,390 - 24,794,477 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	24,791,225 - 24,799,303 (+)	NCBI
Celera	19	22,688,066 - 22,696,153 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

GET3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	12,737,106 - 12,748,323 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	12,737,139 - 12,748,323 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	12,847,920 - 12,859,137 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	12,709,306 - 12,720,137 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	12,709,305 - 12,720,137	NCBI
Celera	19	12,738,017 - 12,748,848 (+)	NCBI		Celera
Cytogenetic Map	19	p13.13	NCBI
HuRef	19	12,421,428 - 12,432,073 (+)	NCBI		HuRef
CHM1_1	19	12,848,768 - 12,859,600 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	12,861,599 - 12,872,815 (+)	NCBI		T2T-CHM13v2.0

Get3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	85,744,558 - 85,751,916 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	85,744,560 - 85,751,910 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	85,017,929 - 85,025,287 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	85,017,931 - 85,025,281 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	87,541,830 - 87,549,177 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	87,908,036 - 87,915,383 (-)	NCBI		MGSCv36	mm8
Celera	8	89,312,886 - 89,320,055 (-)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	41.48	NCBI

Get3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	31,836,294 - 31,843,104 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	31,836,294 - 31,843,046 (+)	NCBI	ChiLan1.0	ChiLan1.0

GET3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	17,666,769 - 17,678,009 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	16,667,339 - 16,678,560 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	12,299,706 - 12,310,923 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	13,045,570 - 13,055,908 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	13,045,570 - 13,055,908 (+)	Ensembl	panpan1.1		panPan2

GET3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	49,392,662 - 49,398,662 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	49,392,662 - 49,398,664 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	49,266,281 - 49,272,270 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	49,911,098 - 49,917,088 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	49,911,099 - 49,917,111 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	49,122,172 - 49,128,161 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	49,548,511 - 49,554,497 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	49,791,179 - 49,797,169 (-)	NCBI		UU_Cfam_GSD_1.0

Get3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	208,496,527 - 208,502,722 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	1,851,051 - 1,858,322 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	1,851,953 - 1,858,176 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GET3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	66,251,432 - 66,260,958 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	66,251,381 - 66,261,135 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	66,632,155 - 66,641,634 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GET3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	11,426,857 - 11,437,343 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	11,426,787 - 11,437,119 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	8,359,262 - 8,370,564 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Get3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624901	361,352 - 368,725 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624901	361,364 - 368,249 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Get3
20 total Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
19	37110541	37110542	T	G	snv	SR/JrHsd (MCW)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	65
Count of miRNA genes:	56
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000067518
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	13926401	30303727	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat

RH129284

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	23,137,924 - 23,138,085 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	26,133,135 - 26,133,295	NCBI	Rnor6.0
Rnor_5.0	19	37,108,758 - 37,108,918	UniSTS	Rnor5.0
RGSC_v3.4	19	24,794,206 - 24,794,366	UniSTS	RGSC3.4
Celera	19	22,695,882 - 22,696,042	UniSTS
Cytogenetic Map	19	q11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001100505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772368	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772369	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA997032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB700861	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000067518 ⟹ ENSRNOP00000059647

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,130,109 - 23,138,193 (+)	Ensembl
Rnor_6.0 Ensembl	19	26,133,027 - 26,141,111 (-)	Ensembl

RefSeq Acc Id:

NM_001100505 ⟹ NP_001093975

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,034,977 - 40,043,064 (+)	NCBI
mRatBN7.2	19	23,130,109 - 23,138,196 (+)	NCBI
Rnor_6.0	19	26,133,024 - 26,141,111 (-)	NCBI
Rnor_5.0	19	37,108,647 - 37,116,734 (-)	NCBI
RGSC_v3.4	19	24,786,390 - 24,794,477 (+)	RGD
Celera	19	22,688,066 - 22,696,153 (+)	RGD

Sequence:

show sequence

CGGGTCCAAGATGGCGGCGGGGGTGGCCGGGTGGGGGGTTGAAGCAGAAGAGTTCGAGGATGCACCTGACGTGGAGCCACTGGAACCCACGCTTAGCAATATCATCGAGCAGCGTAGCCTTAAGTGGA
TCTTCGTCGGGGGCAAAGGAGGCGTTGGTAAGACCACCTGCAGCTGCAGCCTGGCGGTCCAGCTGTCTAAGGGACGGGAGAGTGTTCTCATCATTTCTACAGACCCAGCTCATAACATTTCAGATGCT
TTTGATCAGAAGTTCTCCAAGGTGCCTACCAAGGTCAAAGGCTATGACAACCTCTTTGCTATGGAGATAGACCCCAGCCTGGGCGTTGCAGAGCTCCCCGACGAGTTCTTCGAGGAAGACAACATGCT
GAGCATGGGCAAGAAGATGATGCAGGAGGCCATGAGCGCCTTCCCTGGCATCGATGAGGCCATGAGTTATGCTGAGGTCATGAGGCTGGTGAAAGGCATGAACTTCTCAGTGGTGGTGTTCGACACAG
CACCCACCGGCCATACACTCAGGCTCCTGAACTTCCCCACCATCGTGGAGCGGGGCCTGGGCCGCCTGATGCAGATCAAGAACCAGATCAGCCCCTTCATCTCACAGATGTGCAACATGCTGGGTCTG
GGGGACATGAACGCTGACCAGCTGGCCTCCAAGTTAGAAGAGACCTTGCCCGTCATCCGATCCGTCAGCGAACAGTTCAAGGACCCTGAACAGACGACCTTCATCTGTGTGTGCATCGCCGAGTTTTT
GTCCCTGTATGAGACGGAGCGTCTGATCCAGGAGCTGGCCAAGTGCAAGATCGACACCCACAACATCATCGTCAACCAGCTTGTCTTCCCCGACCCTGAGAAACCCTGCAAGATGTGTGAGGCCCGAC
ACAAGATCCAGGCCAAATACCTGGACCAGATGGAAGACCTCTATGAAGACTTTCACATTGTAAAGCTGCCACTGTTACCTCACGAGGTTCGGGGAGCCGACAAAGTCAACACCTTCTCTGCCCTCCTC
CTGGAGCCCTACAAGCCCCCCAGCACCCAGTAGCCAACCCCATTCCAGCTGCTGCCACTTCATACCCTCCTCTTTCCCCACGGGGCAGAGTTTGCACAAAGTCCCCCATAATGCAGGGGGAGCCACTT
AGGAGGTGGGAGGGGGTCTGTTCCCCCTGGTGGGGCCTGGGGAGGCTGCAATGCCCCCCCACCTCTTCCTGCCTCATACTCCTCAATAAAATAATCTTAAACAGCTGTGTTTGTCCGTGGAGGGTGGG
TAGGTAAGCACTTGTGTGATGATTCTGCACGAGTGTTTGGCTCCCTCTCACACAGGTCCATCCATAGCAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063277831 ⟹ XP_063133901

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,034,675 - 40,042,970 (+)	NCBI


Protein RefSeqs	NP_001093975	(Get FASTA)	NCBI Sequence Viewer
	XP_063133901	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98819	(Get FASTA)	NCBI Sequence Viewer
	EDL92167	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000059647
	ENSRNOP00000059647.1
GenBank Protein	G3V9T7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001093975 ⟸ NM_001100505

- UniProtKB:

G3V9T7 (UniProtKB/TrEMBL), Q4G022 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLSMG
KKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQIKNQISPFISQMCNMLGLGDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLY
ETERLIQELAKCKIDTHNIIVNQLVFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYKPPSTQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000059647 ⟸ ENSRNOT00000067518

RefSeq Acc Id:	XP_063133901 ⟸ XM_063277831
- Peptide Label:	isoform X1
- UniProtKB:	G3V9T7 (UniProtKB/Swiss-Prot), Q4G022 (UniProtKB/TrEMBL)

Protein Domains

Anion-transporting ATPase-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V9T7-F1-model_v2	AlphaFold	G3V9T7	1-348	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701036

Promoter ID:

EPDNEW_R11559

Type:

multiple initiation site

Name:

Asna1_1

Description:

arsA arsenite transporter, ATP-binding, homolog 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	26,141,115 - 26,141,175	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-6139	BioCyc
Ensembl Genes	ENSRNOG00000003747	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000067518	ENTREZGENE
	ENSRNOT00000067518.2	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7377305	IMAGE-MGC_LOAD
InterPro	Anion-transp_ATPase-like_dom	UniProtKB/Swiss-Prot
	ATPase_ArsA/GET3	UniProtKB/Swiss-Prot
	ATPase_ArsA/GET3_euk	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:288919	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112864	IMAGE-MGC_LOAD
NCBI Gene	288919	ENTREZGENE
PANTHER	ATPASE GET3	UniProtKB/Swiss-Prot
	PTHR10803	UniProtKB/Swiss-Prot
Pfam	ArsA_ATPase	UniProtKB/Swiss-Prot
PhenoGen	Get3	PhenoGen
RatGTEx	ENSRNOG00000003747	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	G3V9T7	ENTREZGENE, UniProtKB/Swiss-Prot
	Q4G022	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-07-01	Get3	guided entry of tail-anchored proteins factor 3, ATPase	Asna1	arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Asna1	arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)	Asna1_predicted	arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Asna1_predicted	arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM