Ada (adenosine deaminase) - Rat Genome Database

Name: Ada
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Ada (adenosine deaminase) Chinchilla lanigera

Analyze

Symbol:

Ada

Name:

adenosine deaminase

RGD ID:

8915575

Description:

ENCODES a protein that exhibits 2'-deoxyadenosine deaminase activity (ortholog); adenosine deaminase activity (ortholog); deaminase activity (ortholog); INVOLVED IN adenosine catabolic process (ortholog); adenosine metabolic process (ortholog); allantoin metabolic process (ortholog); PARTICIPATES IN adenine phoshoribosyltransferase deficiency pathway; adenosine monophosphate deaminase deficiency pathway; adenylosuccinate lyase deficiency pathway; ASSOCIATED WITH adenosine deaminase deficiency (ortholog); asthma (ortholog); autism spectrum disorder (ortholog); FOUND IN cell surface (ortholog); cytoplasm (ortholog); cytosol (ortholog)

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADA (adenosine deaminase)	NCBI	Ortholog
Mus musculus (house mouse):	Ada (adenosine deaminase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Ada (adenosine deaminase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ADA (adenosine deaminase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADA (adenosine deaminase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ada (adenosine deaminase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADA (adenosine deaminase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ADA (adenosine deaminase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ada (adenosine deaminase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	12,696,096 - 12,717,488 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955445	12,696,096 - 12,717,488 (+)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenosine deaminase deficiency (ISO)

asthma (ISO)

autism spectrum disorder (ISO)

autistic disorder (ISO)

Brain Hypoxia-Ischemia (ISO)

Cadmium Poisoning (ISO)

Chemical and Drug Induced Liver Injury (ISO)

colon cancer (ISO)

colorectal cancer (ISO)

Coronary Disease (ISO)

diabetes mellitus (ISO)

Experimental Diabetes Mellitus (ISO)

Experimental Liver Cirrhosis (ISO)

familial hyperlipidemia (ISO)

focal epilepsy (ISO)

gastric ulcer (ISO)

genetic disease (ISO)

Hyperemia (ISO)

hyperglycemia (ISO)

hypertension (ISO)

Hypertriglyceridemia (ISO)

laryngeal squamous cell carcinoma (ISO)

Legionnaires' disease (ISO)

leptospirosis (ISO)

lung disease (ISO)

Lung Neoplasms (ISO)

lung non-small cell carcinoma (ISO)

lymphopenia (ISO)

malignant mesothelioma (ISO)

Malignant Pleural Effusions (ISO)

Mycoplasma pneumoniae pneumonia (ISO)

Myocardial Reperfusion Injury (ISO)

obesity (ISO)

oral cavity cancer (ISO)

oral squamous cell carcinoma (ISO)

peritonitis (ISO)

Pleural Effusion (ISO)

pleural tuberculosis (ISO)

pleurisy (ISO)

primary immunodeficiency disease (ISO)

pulmonary edema (ISO)

pulmonary sarcoidosis (ISO)

pulmonary tuberculosis (ISO)

Q fever (ISO)

severe combined immunodeficiency (ISO)

severe combined immunodeficiency, autosomal recessive, T cell-negative, B cell-negative, NK cell-positive (ISO)

spinal cord disease (ISO)

sporotrichosis (ISO)

stomach cancer (ISO)

T-Cell Immunodeficiency, Recurrent Infections, and Autoimmunity with or without Cardiac Malformations (ISO)

tongue squamous cell carcinoma (ISO)

trypanosomiasis (ISO)

type 2 diabetes mellitus (ISO)

uterine fibroid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenosine catabolic process (ISO)

adenosine metabolic process (ISO)

allantoin metabolic process (ISO)

alpha-beta T cell differentiation (ISO)

amide catabolic process (ISO)

AMP catabolic process (ISO)

AMP salvage (ISO)

apoptotic process (ISO)

B cell proliferation (ISO)

calcium-mediated signaling (ISO)

dAMP catabolic process (ISO)

dATP catabolic process (ISO)

deoxyadenosine catabolic process (ISO)

embryonic digestive tract development (ISO)

germinal center B cell differentiation (ISO)

germinal center formation (ISO)

GMP salvage (ISO)

histamine secretion (ISO)

hypoxanthine biosynthetic process (ISO)

in utero embryonic development (ISO)

inosine biosynthetic process (ISO)

leukocyte migration (ISO)

liver development (ISO)

lung alveolus development (ISO)

lung development (ISO)

mature B cell apoptotic process (ISO)

mucus secretion (ISO)

negative regulation of adenosine receptor signaling pathway (ISO)

negative regulation of apoptotic process (ISO)

negative regulation of circadian sleep/wake cycle, non-REM sleep (ISO)

negative regulation of inflammatory response (ISO)

negative regulation of leukocyte migration (ISO)

negative regulation of mature B cell apoptotic process (ISO)

negative regulation of mucus secretion (ISO)

negative regulation of penile erection (ISO)

negative regulation of thymocyte apoptotic process (ISO)

penile erection (ISO)

Peyer's patch development (ISO)

placenta development (ISO)

positive regulation of alpha-beta T cell differentiation (ISO)

positive regulation of B cell proliferation (ISO)

positive regulation of calcium-mediated signaling (ISO)

positive regulation of germinal center formation (ISO)

positive regulation of heart rate (ISO)

positive regulation of smooth muscle contraction (ISO)

positive regulation of T cell activation (ISO)

positive regulation of T cell differentiation (ISO)

positive regulation of T cell differentiation in thymus (ISO)

positive regulation of T cell receptor signaling pathway (ISO)

purine nucleotide salvage (ISO)

regulation of cell-cell adhesion mediated by integrin (ISO)

regulation of circadian sleep/wake cycle, sleep (ISO)

regulation of T cell differentiation (ISO)

regulation of T cell differentiation in thymus (ISO)

response to cadmium ion (ISO)

response to hydrogen peroxide (ISO)

response to hypoxia (ISO)

response to inorganic substance (ISO)

response to L-arginine (ISO)

response to purine-containing compound (ISO)

response to vitamin E (ISO)

response to xenobiotic stimulus (ISO)

smooth muscle contraction (ISO)

T cell activation (ISO)

T cell differentiation (ISO)

T cell differentiation in thymus (ISO)

T cell receptor signaling pathway (ISO)

thymocyte apoptotic process (ISO)

trophectodermal cell differentiation (ISO)

xanthine biosynthetic process (ISO)

Cellular Component

cell surface (ISO)

cytoplasm (ISO)

cytosol (ISO)

dendrite cytoplasm (ISO)

external side of plasma membrane (ISO)

extracellular space (ISO)

lysosome (ISO)

membrane (ISO)

neuronal cell body (ISO)

plasma membrane (ISO)

Molecular Function

2'-deoxyadenosine deaminase activity (ISO)

adenosine deaminase activity (ISO)

deaminase activity (ISO)

protein binding (ISO)

purine nucleoside binding (ISO)

zinc ion binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

adenine phoshoribosyltransferase deficiency pathway (ISO)

adenosine monophosphate deaminase deficiency pathway (ISO)

adenylosuccinate lyase deficiency pathway (ISO)

AICA-ribosuria pathway (ISO)

azathioprine pharmacodynamics pathway (ISO)

Kelley-Seegmiller syndrome pathway (ISO)

Lesch-Nyhan syndrome pathway (ISO)

mercaptopurine pharmacodynamics pathway (ISO)

molybdenum cofactor deficiency pathway (ISO)

purine metabolic pathway (ISO)

purine nucleoside phosphorylase deficiency pathway (ISO)

tioguanine pharmacodynamics pathway (ISO)

xanthinuria type I pathway (ISO)

xanthinuria pathway (ISO)

xanthinuria type II pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline

Additional References at PubMed

PMID:22301074	PMID:30032202

Genomics

Comparative Map Data

Ada
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	12,696,096 - 12,717,488 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955445	12,696,096 - 12,717,488 (+)	NCBI	ChiLan1.0	ChiLan1.0

ADA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	44,619,522 - 44,651,699 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	44,584,896 - 44,652,252 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	43,248,163 - 43,280,340 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	42,681,577 - 42,713,790 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	42,681,577 - 42,713,790	NCBI
Celera	20	39,956,805 - 39,989,017 (-)	NCBI		Celera
Cytogenetic Map	20	q13.12	NCBI
HuRef	20	39,989,704 - 40,021,872 (-)	NCBI		HuRef
CHM1_1	20	43,151,279 - 43,183,492 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	46,355,294 - 46,387,474 (-)	NCBI		T2T-CHM13v2.0

Ada
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	163,565,703 - 163,592,154 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	163,568,504 - 163,592,159 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	163,726,571 - 163,750,239 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	163,726,584 - 163,750,239 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	163,552,320 - 163,575,913 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	163,418,025 - 163,441,618 (-)	NCBI		MGSCv36	mm8
Celera	2	169,670,309 - 169,693,933 (-)	NCBI		Celera
Cytogenetic Map	2	H3	NCBI
cM Map	2	84.44	NCBI

Ada
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	172,818,174 - 172,842,283 (-)	NCBI		GRCr8
mRatBN7.2	3	152,398,745 - 152,422,854 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	152,398,747 - 152,447,088 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	156,206,205 - 156,230,314 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	164,705,138 - 164,729,255 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	162,449,261 - 162,473,358 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	160,115,840 - 160,139,947 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	160,115,842 - 160,139,947 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	166,306,001 - 166,330,108 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	154,636,530 - 154,660,637 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	154,542,567 - 154,566,673 (-)	NCBI
Celera	3	151,051,040 - 151,075,153 (-)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

ADA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	50,352,747 - 50,384,972 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	50,345,850 - 50,378,060 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	40,950,238 - 40,982,481 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	42,044,613 - 42,076,868 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	42,044,613 - 42,076,868 (-)	Ensembl	panpan1.1		panPan2

ADA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	32,083,786 - 32,119,810 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	32,083,931 - 32,111,160 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	31,725,150 - 31,756,275 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	32,790,716 - 32,821,895 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	32,790,730 - 32,818,187 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	32,052,411 - 32,083,510 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	32,167,117 - 32,198,181 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	32,708,375 - 32,739,510 (-)	NCBI		UU_Cfam_GSD_1.0

Ada
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	181,082,150 - 181,103,907 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936530	2,217,713 - 2,224,070 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	47,044,497 - 47,072,245 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	47,044,492 - 47,072,232 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	52,502,115 - 52,544,469 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	19,167,209 - 19,200,233 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666050	67,836,179 - 67,868,616 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ada
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624790	9,809,492 - 9,829,883 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624790	9,809,550 - 9,829,199 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_005392467	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01039761	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBBH01228991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSCLAT00000017020 ⟹ ENSCLAP00000016855

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955445	12,696,096 - 12,717,488 (+)	Ensembl

RefSeq Acc Id:

XM_005392467 ⟹ XP_005392524

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955445	12,696,096 - 12,717,488 (+)	NCBI

Sequence:

show sequence

GCGGGGCCCGGCGGAGTATAGAAGAACTTGGCCGGCGCCGGCCACTGAGGGCCCCCGGGGATCG
GACGGCCACCGATCGGCGAGACCCACCGAGCTTCGGCCGAAGGAGCAGCGCTAGTGCGCACGCT
GGGCACCATGACACCTGCACCTGCCTTCAACAAGCCCAAAGTGGAGCTGCACGTCCACCTGGAT
GGAAGCATCAAGCCCGAAACCATCTTGTACTTCGGCAAGAAGAGAGGGATCGCCCTTCCGGCTG
ACACAGCGGAGGAGCTGCAGAAGATCATCGGCATGGACAAACCAGAGTCCCTCCCGTACTTCCT
GTCCAAGTTTGAGTACTACATGCCTGCTATCGCGGGCAGCAGGGAAGCCATCAAAAGGATCGCC
TATGAGTTCGTGGAGATGAAGGCCAAGGAGGGCGTGGTGTACGTGGAGGTGCGCTACAGCCCGC
ACCTGCTGGCCAACTCCAAAGTGGAGCCAATCCCCTGGAACCAGGCCGAAGGGGACCTCACCCC
CGACGAGGTGGCAGACCTCGTGAACCAGGGCCTGCGTGAGGGGGAGAAAGCCTTCGGCATCAAG
GCCAGGTCCATCCTGTGCTGCATGCGCCACCAGCCGGAATGGTCCCCTGAGGTGGTGGAGATGT
GTAAGAAGTACCGGCACCAGGGTACGGTGGCCATGGACATGGCTGGCGACGAGAACATCCAAGG
CAGCAGCTACTTCCCGGGGCACCTGGAGGCCTACAAGGAGGCAGTGAGGAGCGGCATTCACCGC
ACCGTCCATGCCGGGGAGGTGTGCTCCCCAGAGATCGTGCGCGAGGCTGTGGACGTACTCAAGA
CGGAGAGGGTGGGGCACGGCTACCACACCCTGGAGGACGAGGCCCTTTACGCCAGGTTACGGAA
GGAAAACATGCACTTCGAGGTGTGTCCCTGGTCCAGCTACCTCACAGGCGCGTGGAAGGCGGAA
ACGGAGCACCCAGTGGTTCGGTTCAAGAACGACAAAGTTAACTACTCGCTCAACTCAGATGACC
CGCTTATCTTCATGTCTACCCTGGACACTGACTACCAGATGACCAAACGGGACATGGGCTTTAC
TGAGGAGGAGTTTAAGCGACTGAACATCAATGCCGCCAAGTCCAGCTTCCTCCCAGAGGATGAG
AAGGAGGAGCTCCTCAACCAGCTCTACAAAGCCTACGGGATGCCACTGCCGCCAGCCGCTGCTG
CAGGGCAGGACCCCTGAAGATGGCATGGCCTCCTCTGAGCCCTCACCCCACGGATGGAGCCTGC
ACAACTCTGTGGGATCAAGTGACACTTAACCTGAATTCCCTCCTCAAGACTAAGACTTTAGGAG
TTAGCTACTGTTGTGTATCACACGCACAAACCTGGGAATGGCCACTTCTCACCTCTGATTGTGT
ATCCTTCCCAGGGACTAGAGCCCTTGTCAAGGGTGACCGTGAATCTGAGGCCCCCTGTCCTCAG
ATGACTCGTGCTGAAAATCTGGTGCTCAATAAAGCTGCCAGTGGCTGGCACTGTATAGCC

hide sequence

Protein Sequences


Protein RefSeqs	XP_005392524	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCLAP00000016855
	ENSCLAP00000016855.1

RefSeq Acc Id:

XP_005392524 ⟸ XM_005392467

- UniProtKB:

A0A8C2VSH4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTPAPAFNKPKVELHVHLDGSIKPETILYFGKKRGIALPADTAEELQKIIGMDKPESLPYFLSK
FEYYMPAIAGSREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDE
VADLVNQGLREGEKAFGIKARSILCCMRHQPEWSPEVVEMCKKYRHQGTVAMDMAGDENIQGSS
YFPGHLEAYKEAVRSGIHRTVHAGEVCSPEIVREAVDVLKTERVGHGYHTLEDEALYARLRKEN
MHFEVCPWSSYLTGAWKAETEHPVVRFKNDKVNYSLNSDDPLIFMSTLDTDYQMTKRDMGFTEE
EFKRLNINAAKSSFLPEDEKEELLNQLYKAYGMPLPPAAAAGQDP

hide sequence

RefSeq Acc Id:

ENSCLAP00000016855 ⟸ ENSCLAT00000017020

Protein Domains

Adenosine deaminase

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSCLAG00000011565	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCLAT00000017020	ENTREZGENE
	ENSCLAT00000017020.1	UniProtKB/TrEMBL
Gene3D-CATH	Metal-dependent hydrolases	UniProtKB/TrEMBL
InterPro	A/AMP_deam_AS	UniProtKB/TrEMBL
	A_deaminase	UniProtKB/TrEMBL
	A_deaminase_dom	UniProtKB/TrEMBL
	Ado/ade_deaminase	UniProtKB/TrEMBL
	Metal_Hydrolase	UniProtKB/TrEMBL
NCBI Gene	Ada	ENTREZGENE
PANTHER	ADENOSINE DEAMINASE	UniProtKB/TrEMBL
	PTHR11409	UniProtKB/TrEMBL
Pfam	A_deaminase	UniProtKB/TrEMBL
PROSITE	A_DEAMINASE	UniProtKB/TrEMBL
Superfamily-SCOP	SSF51556	UniProtKB/TrEMBL
UniProt	A0A8C2VSH4	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB