Tfb1m (transcription factor B1, mitochondrial)

Gene: Tfb1m (transcription factor B1, mitochondrial) Rattus norvegicus

Analyze

Symbol:

Tfb1m

Name:

transcription factor B1, mitochondrial

RGD ID:

727795

Description:

Predicted to enable mitochondrial transcription factor activity and rRNA (adenine-N6,N6-)-dimethyltransferase activity. Predicted to be involved in rRNA methylation and transcription initiation at mitochondrial promoter. Predicted to be located in mitochondrial nucleoid. Predicted to be active in mitochondrial matrix. Orthologous to human TFB1M (transcription factor B1, mitochondrial); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

dimethyladenosine transferase 1, mitochondrial; mitochondrial 12S rRNA dimethylase 1; mitochondrial transcription factor B1; mtTFB1; S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TFB1M (transcription factor B1, mitochondrial)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Tfb1m (transcription factor B1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tfb1m (transcription factor B1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TFB1M (transcription factor B1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TFB1M (transcription factor B1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tfb1m (transcription factor B1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TFB1M (transcription factor B1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TFB1M (transcription factor B1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tfb1m (transcription factor B1, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TFB1M (transcription factor B1, mitochondrial)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tfb1m (transcription factor B1, mitochondrial)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tfb1m (transcription factor B1, mitochondrial)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tfbm-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mtTFB1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tfb1m	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	46,520,510 - 46,567,004 (-)	NCBI		GRCr8
mRatBN7.2	1	44,115,240 - 44,161,737 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	44,119,166 - 44,161,709 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	44,660,116 - 44,702,630 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	50,647,350 - 50,689,863 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	44,735,618 - 44,778,128 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	44,433,116 - 44,474,674 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	44,433,116 - 44,474,674 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	45,762,960 - 45,804,760 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	38,513,709 - 38,556,210 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	38,516,653 - 38,559,155 (-)	NCBI
Celera	1	39,753,776 - 39,795,383 (-)	NCBI		Celera
Cytogenetic Map	1	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 6q24-q25 deletion syndrome (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

3-chloropropane-1,2-diol (EXP)

4-amino-2,6-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

amiodarone (ISO)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butan-1-ol (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

dicrotophos (ISO)

dimethyl fumarate (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

isobutanol (ISO)

ivermectin (ISO)

leflunomide (EXP)

lipopolysaccharide (ISO)

methimazole (EXP)

paracetamol (ISO)

pirinixic acid (ISO)

poly(I:C) (EXP)

potassium chromate (ISO)

Ptaquiloside (ISO)

quercetin (ISO)

quercitrin (ISO)

resveratrol (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

T-2 toxin (EXP)

teriflunomide (ISO)

tetrathiomolybdate(2-) (EXP)

Triptolide (ISO)

trovafloxacin (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

rRNA methylation (IBA,IEA,ISO,ISS)

transcription initiation at mitochondrial promoter (IBA,IEA)

Cellular Component

mitochondrial DNA-directed RNA polymerase complex (IEA)

mitochondrial matrix (IBA)

mitochondrial nucleoid (IEA,ISO)

Molecular Function

DNA binding (IEA)

mitochondrial transcription factor activity (IBA,IEA)

protein binding (ISO)

RNA binding (IEA)

rRNA (adenine-N6,N6-)-dimethyltransferase activity (IBA,IEA,ISO,ISS)

S-adenosyl-L-methionine binding (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Mitochondrial transcription factors B1 and B2 activate transcription of human mtDNA.	Falkenberg M, etal., Nat Genet 2002 Jul;31(3):289-94.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12496758	PMID:15489334	PMID:18063578	PMID:18614015	PMID:22658674	PMID:23303773

Genomics

Comparative Map Data

Tfb1m
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	46,520,510 - 46,567,004 (-)	NCBI		GRCr8
mRatBN7.2	1	44,115,240 - 44,161,737 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	44,119,166 - 44,161,709 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	44,660,116 - 44,702,630 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	50,647,350 - 50,689,863 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	44,735,618 - 44,778,128 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	44,433,116 - 44,474,674 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	44,433,116 - 44,474,674 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	45,762,960 - 45,804,760 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	38,513,709 - 38,556,210 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	38,516,653 - 38,559,155 (-)	NCBI
Celera	1	39,753,776 - 39,795,383 (-)	NCBI		Celera
Cytogenetic Map	1	q11	NCBI

TFB1M
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	155,229,871 - 155,314,484 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	155,256,134 - 155,314,493 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	155,551,005 - 155,635,618 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	155,620,482 - 155,677,318 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	155,670,910 - 155,727,731	NCBI
Celera	6	156,313,087 - 156,369,927 (-)	NCBI		Celera
Cytogenetic Map	6	q25.3	NCBI
HuRef	6	153,139,544 - 153,197,988 (-)	NCBI		HuRef
CHM1_1	6	155,839,879 - 155,897,947 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	156,431,886 - 156,516,508 (-)	NCBI		T2T-CHM13v2.0

Tfb1m
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	3,569,119 - 3,608,064 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	3,569,531 - 3,608,056 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	3,519,250 - 3,557,796 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	3,519,256 - 3,557,781 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	3,519,256 - 3,557,713 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	3,475,738 - 3,514,195 (-)	NCBI		MGSCv36	mm8
Celera	17	4,054,051 - 4,093,093 (-)	NCBI		Celera
Cytogenetic Map	17	A1	NCBI
cM Map	17	2.01	NCBI

Tfb1m
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955439	6,883,852 - 6,943,152 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955439	6,889,432 - 6,943,152 (+)	NCBI	ChiLan1.0	ChiLan1.0

TFB1M
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	175,281,025 - 175,337,446 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	173,171,102 - 173,228,972 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	153,072,906 - 153,130,545 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	159,034,430 - 159,094,588 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	159,037,203 - 159,094,592 (-)	Ensembl	panpan1.1		panPan2

TFB1M
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	45,001,095 - 45,071,361 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	45,001,088 - 45,071,518 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	45,838,091 - 45,908,486 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	45,184,445 - 45,255,052 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	45,182,619 - 45,255,027 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	45,051,617 - 45,121,984 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	44,923,363 - 44,993,740 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	45,479,603 - 45,549,987 (-)	NCBI		UU_Cfam_GSD_1.0

Tfb1m
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	140,210,776 - 140,258,128 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936489	7,464,663 - 7,510,123 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936489	7,464,550 - 7,510,108 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TFB1M
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	11,566,245 - 11,653,871 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	11,566,193 - 11,650,656 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	13,558,903 - 13,622,456 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TFB1M
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	82,823,528 - 82,877,958 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	82,823,640 - 82,877,923 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	55,194,167 - 55,253,100 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tfb1m
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624785	3,027,230 - 3,085,879 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624785	3,027,662 - 3,085,879 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tfb1m
172 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	70
Count of miRNA genes:	56
Interacting mature miRNAs:	66
Transcripts:	ENSRNOT00000022397
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	15431621	49361612	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	0.00000072	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	15431621	49361612	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	16206210	49268520	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1357397	Bw41	Body weight QTL 41	4.19	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	20	34	18	18	18	1	1	74	32	40	11	1
Low	1	23	23	23	1	23	7	10		3	1		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_181474	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005504530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC109122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY198392	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC070907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474052	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000078768 ⟹ ENSRNOP00000070930

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	44,119,166 - 44,161,709 (-)	Ensembl
Rnor_6.0 Ensembl	1	44,433,116 - 44,474,674 (-)	Ensembl

RefSeq Acc Id:

NM_181474 ⟹ NP_852139

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	46,524,435 - 46,566,948 (-)	NCBI
mRatBN7.2	1	44,119,165 - 44,161,680 (-)	NCBI
Rnor_6.0	1	44,433,116 - 44,474,674 (-)	NCBI
Rnor_5.0	1	45,762,960 - 45,804,760 (-)	NCBI
RGSC_v3.4	1	38,513,709 - 38,556,210 (-)	RGD
Celera	1	39,753,776 - 39,795,383 (-)	RGD

Sequence:

show sequence

CGCGTGTGTATGTAGGTCTCATGGCTGCCTCGGGAAAGCTCGGCACTTTCCGCCTCCCCCCGTT
ACCCACCATTCGAGAAATCATTAAGTTGTTCGGACTGCGAGCGGCGAAGCAGCTTTCCCAGAAT
TTCCTCCTGGACTTGAGGCTGACAGACAAAATTGTAAGGAAAGCTGGCAGTCTAGCAGATGTTT
ATGTTTATGAAGTGGGTCCGGGGCCCGGGGGAATCACAAGATCCATCCTCAATGCTGATATTGC
CGAGCTTCTGGTGGTTGAAAAGGATACTCGGTTTATTCCAGGATTACAGATGCTTTCTGATGCA
GCACCTGGAAAACTCCGAATTGTTCATGGAGATGTGCTGACGTATAAGATAGAAAAGGCTTTTC
CAGACAACATTAGAAGACAGTGGGAAGATGATCCTCCAAATGTACATATTATTGGAAACCTGCC
TTTTAGTGTTTCAACCCCACTGATTATCAAGTGGCTTGAAAATATTTCTCTTAAAAATGGCCCT
TTCGTTTACGGCAGAACTAAGATGACGTTAACATTTCAAAAGGAAGTGGCGGAGAGACTTGTAG
CCACTACAGGAAGCAAACAGCGCAGTCGTCTTTCCATTATGGCCCAGTACCTCTGCAATGTTGA
GCACCTCTTTACAATCCCAGGAAAGGCTTTTGTTCCCAAACCAGAGGTTGATGTAGGAGTGGTG
CACCTTATGCCCTTGGTACAGCCCAAGATCAAGCAGCCATTCAAGCTGGTAGAAAAAGTTGTCC
AGAATGTGTTTCAGTTTCGAAGGAAATATTGCCACCGAGGGCTTGGAATGTTATTCCCTGAAGC
ACAGCGCCTGGAAAGCACTGGAAGGCTGTTACAGCTAGCTGACATTGATCCAACGCTCCGGCCC
ACTCACCTCTCGCTCATGCATTTTAAGAGTTTATGTGATGTGTACAGAAAAATGTGTGATGAAG
ACCCACAACTCTTTGCTTATAACTTCAGAGAAGAGCTCAAGCAAAAGAAAAGGAAAGGTCAAGA
AAAAGATGGTGACTCAGAAAGCTGTGGGTTCTAACTGCTGTCTTAGGGCTCCCGACTGGCAGTC
TCGATCCACAGTGTGGATCTCCACATGTGGACATGTGCTTCCCTCCCACTCTGTAAAGACAAAT
ACTGATGACCTCATGCCAAGTAGATCCAATGCATGCAAGCTTTTTCTTTAAATACATATATATA
TGTATATATATATATATTGAATAGATAAGACATGTTTAGTATAAACAGCATTTATTACAACCTT
CCAAAATGAAATGTCTGCACATTGTGCCCCTAAACCATGTAAACATAAATGTGCTTTAAATGAA
GCAAAAACTAACAGCGCAAAGAAAATGCCCAAAGGACTGGGGGGAGGGGCCTTTAAAAGCTATT
AATCACAACGTTCCCAATCTTATCCCACATAACTTAAAATAATTAGAATGCAATTTTATTACAA
GACTAAAAATCATTTGATTCCTGCTCAAAAGGGATAGAAGCTAGTAATTTACAGATTCTGACCA
ACTAAATCTAGTTTTCTGATTCACAATAAATTAAAATAACTTAAATCTTAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039110653 ⟹ XP_038966581

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	46,526,815 - 46,567,004 (-)	NCBI
mRatBN7.2	1	44,121,550 - 44,161,737 (-)	NCBI

RefSeq Acc Id:

XM_039110661 ⟹ XP_038966589

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	46,542,307 - 46,567,002 (-)	NCBI
mRatBN7.2	1	44,136,254 - 44,161,734 (-)	NCBI

RefSeq Acc Id:

XM_039110671 ⟹ XP_038966599

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	46,520,510 - 46,564,275 (-)	NCBI
mRatBN7.2	1	44,115,240 - 44,161,711 (-)	NCBI

RefSeq Acc Id:

XR_005504530

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	46,526,817 - 46,567,002 (-)	NCBI
mRatBN7.2	1	44,121,545 - 44,161,734 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_852139	(Get FASTA)	NCBI Sequence Viewer
	XP_038966581	(Get FASTA)	NCBI Sequence Viewer
	XP_038966589	(Get FASTA)	NCBI Sequence Viewer
	XP_038966599	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH70907	(Get FASTA)	NCBI Sequence Viewer
	AAO42744	(Get FASTA)	NCBI Sequence Viewer
	EDL92822	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070930
	ENSRNOP00000070930.1
GenBank Protein	Q811P6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_852139 ⟸ NM_181474

- UniProtKB:

Q6IRI6 (UniProtKB/Swiss-Prot), Q811P6 (UniProtKB/Swiss-Prot), A0A0G2JZ68 (UniProtKB/TrEMBL), A6KIQ6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAASGKLGTFRLPPLPTIREIIKLFGLRAAKQLSQNFLLDLRLTDKIVRKAGSLADVYVYEVGP
GPGGITRSILNADIAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTYKIEKAFPDNIRRQ
WEDDPPNVHIIGNLPFSVSTPLIIKWLENISLKNGPFVYGRTKMTLTFQKEVAERLVATTGSKQ
RSRLSIMAQYLCNVEHLFTIPGKAFVPKPEVDVGVVHLMPLVQPKIKQPFKLVEKVVQNVFQFR
RKYCHRGLGMLFPEAQRLESTGRLLQLADIDPTLRPTHLSLMHFKSLCDVYRKMCDEDPQLFAY
NFREELKQKKRKGQEKDGDSESCGF

hide sequence

RefSeq Acc Id:

ENSRNOP00000070930 ⟸ ENSRNOT00000078768

RefSeq Acc Id:	XP_038966599 ⟸ XM_039110671
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038966581 ⟸ XM_039110653
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038966589 ⟸ XM_039110661
- Peptide Label:	isoform X2

Protein Domains

Ribosomal RNA adenine methylase transferase N-

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q811P6-F1-model_v2	AlphaFold	Q811P6	1-345	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689601

Promoter ID:

EPDNEW_R124

Type:

initiation region

Name:

Tfb1m_1

Description:

transcription factor B1, mitochondrial

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	44,474,694 - 44,474,754	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727795	AgrOrtholog
BioCyc Gene	G2FUF-61664	BioCyc
Ensembl Genes	ENSRNOG00000056223	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000078768	ENTREZGENE
	ENSRNOT00000078768.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.8.100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.150	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7102927	IMAGE-MGC_LOAD
InterPro	KsgA/Erm	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	rRNA_Ade_diMease-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	rRNA_Ade_Mease_Trfase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	rRNA_Ade_methylase_Trfase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	rRNA_adenine_dimethylase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SAM-dependent_MTases	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:308140	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:91415	IMAGE-MGC_LOAD
NCBI Gene	308140	ENTREZGENE
PANTHER	DIMETHYLADENOSINE TRANSFERASE 1, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11727	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RrnaAD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tfb1m	PhenoGen
PROSITE	RRNA_A_DIMETH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SAM_RNA_A_N6_MT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000056223	RatGTEx
SMART	rADc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF53335	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JZ68	ENTREZGENE, UniProtKB/TrEMBL
	A6KIQ6	ENTREZGENE, UniProtKB/TrEMBL
	Q6IRI6	ENTREZGENE
	Q811P6	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q6IRI6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Tfb1m	transcription factor B1, mitochondrial			Symbol and Name status set to approved	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_protein	in humans, tfb1m is at least one order of magnitude less active than tfb2m	1302396

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar