Gnb3 (G protein subunit beta 3) - Rat Genome Database

Name: Gnb3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Gnb3 (G protein subunit beta 3) Rattus norvegicus

Analyze

Symbol:

Gnb3

Name:

G protein subunit beta 3

RGD ID:

708344

Description:

Enables spectrin binding activity. Predicted to be involved in several processes, including cell volume homeostasis; regulation of fat cell differentiation; and regulation of lipid metabolic process. Located in cell body. Human ortholog(s) of this gene implicated in artery disease (multiple); congenital stationary night blindness 1H; depressive disorder; familial hyperlipidemia; and type 2 diabetes mellitus. Orthologous to human GNB3 (G protein subunit beta 3); PARTICIPATES IN visual phototransduction pathway; chemokine mediated signaling pathway; glutamate signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; aconitine; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G protein beta-subunit; G protein beta-subunit gene; guanine nucleotide binding protein (G protein), beta 3; guanine nucleotide binding protein (G protein), beta polypeptide 3; guanine nucleotide binding protein, beta 3; guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3; guanine nucleotide-binding protein, beta-3 subunit; heterotrimeric guanine nucleotide-binding protein 2d; Hg2d; LOC60449; MGC105437; transducin beta chain 3

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNB3 (G protein subunit beta 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gnb3 (guanine nucleotide binding protein (G protein), beta 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gnb3 (G protein subunit beta 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNB3 (G protein subunit beta 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNB3 (G protein subunit beta 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gnb3 (G protein subunit beta 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNB3 (G protein subunit beta 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNB3 (G protein subunit beta 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gnb3 (G protein subunit beta 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GNB3 (G protein subunit beta 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gnb3 (guanine nucleotide binding protein (G protein), beta 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gnb3a (guanine nucleotide binding protein (G protein), beta polypeptide 3a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	gnb3b (guanine nucleotide binding protein (G protein), beta polypeptide 3b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	gpb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Gbeta13F	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	STE4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gnb3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Allele / Splice:

Gnb3^em1Mcwi

Genetic Models:

SS-Gnb3^em1Mcwi

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	159,325,741 - 159,331,443 (-)	NCBI		GRCr8
mRatBN7.2	4	157,639,468 - 157,645,171 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	157,639,469 - 157,645,173 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	163,867,751 - 163,873,454 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	159,650,661 - 159,656,363 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	158,286,144 - 158,291,844 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	157,352,558 - 157,359,237 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	157,352,372 - 157,358,262 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	224,370,234 - 224,376,918 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	160,957,524 - 160,963,226 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	161,202,460 - 161,208,162 (-)	NCBI
Celera	4	146,377,383 - 146,383,085 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

carotid artery disease (ISO)

congenital stationary night blindness (ISO)

congenital stationary night blindness 1H (ISO)

coronary artery disease (ISO)

depressive disorder (ISO)

developmental and epileptic encephalopathy 21 (ISO)

diabetes mellitus (ISO)

essential hypertension (ISO)

familial hyperlipidemia (ISO)

genetic disease (ISO)

Hyperphosphatemic Familial Tumoral Calcinosis 1 (ISO)

hypertension (ISO)

Insulin Resistance (ISO)

Klippel-Feil syndrome 3 (ISO)

lymphoproliferative syndrome 2 (ISO)

obesity (ISO)

Orthostatic Hypotension (ISO)

peroxisome biogenesis disorder 2B (ISO)

Temtamy syndrome (ISO)

type 2 diabetes mellitus (ISO)

Weight Gain (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

aconitine (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

atrazine (ISO)

barium(0) (ISO)

bisphenol A (EXP)

clozapine (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

cytarabine (ISO)

dextran sulfate (ISO)

folic acid (ISO)

gallic acid (ISO)

iron dichloride (ISO)

leflunomide (ISO)

methamphetamine (EXP)

mono(2-ethylhexyl) phthalate (ISO)

nitroglycerin (ISO)

nortriptyline (ISO)

paracetamol (ISO)

PCB138 (ISO)

picoxystrobin (ISO)

potassium dichromate (ISO)

rotenone (EXP)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sunitinib (ISO)

tebufenpyrad (ISO)

thifluzamide (ISO)

titanium dioxide (ISO)

triclosan (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cell volume homeostasis (ISO)

G protein-coupled receptor signaling pathway (IBA)

regulation of cholesterol metabolic process (ISO)

regulation of fat cell differentiation (ISO)

regulation of feeding behavior (ISO)

regulation of gene expression (ISO)

regulation of glucose metabolic process (ISO)

regulation of hormone metabolic process (ISO)

regulation of locomotion involved in locomotory behavior (ISO)

regulation of phospholipid metabolic process (ISO)

regulation of triglyceride metabolic process (ISO)

Cellular Component

cell body (IDA)

cytoplasm (IBA)

dendrite (ISO)

heterotrimeric G-protein complex (IBA,ISO)

Molecular Function

GTPase binding (ISO)

protein binding (ISO)

signaling receptor complex adaptor activity (IBA)

spectrin binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

visual phototransduction pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Photoreceptor signaling: supporting vision across a wide range of light intensities.	Arshavsky VY and Burns ME, J Biol Chem. 2012 Jan 13;287(3):1620-6. Epub 2011 Nov 10.
2.	Salt consumption-dependent association of the GNB3 gene polymorphism with type 2 DM.	Daimon M, etal., Biochem Biophys Res Commun. 2008 Sep 26;374(3):576-80. Epub 2008 Jul 24.
3.	G protein beta3 subunit 825T allele is associated with depression in young, healthy subjects.	Exton MS, etal., Neuroreport 2003 Mar 3;14(3):531-3.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Association of the C825T polymorphism of the G-protein beta3 subunit gene with hypertension, obesity, hyperlipidemia, insulin resistance, diabetes, diabetic complications, and diabetic therapies among Japanese.	Hayakawa T, etal., Metabolism. 2007 Jan;56(1):44-8.
6.	Association between a polymorphism in the G protein beta3 subunit gene (GNB3) with arterial hypertension but not with myocardial infarction.	Hengstenberg C, etal., Cardiovasc Res. 2001 Mar;49(4):820-7.
7.	825T allele of the G-protein beta3 subunit gene (GNB3) is associated with impaired left ventricular diastolic filling in essential hypertension.	Jacobi J, etal., J Hypertens. 1999 Oct;17(10):1457-62.
8.	Interactions between the FTO and GNB3 genes contribute to varied clinical phenotypes in hypertension.	Kumar R, etal., PLoS One. 2013 May 14;8(5):e63934. doi: 10.1371/journal.pone.0063934. Print 2013.
9.	Immunohistochemical localization of G protein beta1, beta2, beta3, beta4, beta5, and gamma3 subunits in the adult rat brain.	Liang JJ, etal., J Neurochem. 1998 Jul;71(1):345-55.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
12.	The giant spectrin betaV couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.	Papal S, etal., Hum Mol Genet. 2013 Sep 15;22(18):3773-88. doi: 10.1093/hmg/ddt228. Epub 2013 May 23.
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	Cloning and sequencing of a rat heart cDNA encoding a G-protein beta subunit related to the human retinal beta 3 subunit.	Ray K and Robishaw JD, Gene 1994 Nov 18;149(2):337-40.
15.	G-protein beta3 subunit (GNB3) gene polymorphisms and cardiovascular disease: the Ludwigshafen Risk and Cardiovascular Health (LURIC) study.	Renner W, etal., Atherosclerosis. 2007 May;192(1):108-12. Epub 2006 Aug 14.
16.	GOA pipeline	RGD automated data pipeline
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	Comprehensive gene review and curation	RGD comprehensive gene curation
19.	Polymorphisms of genes encoding components of the sympathetic nervous system but not the renin-angiotensin system as risk factors for orthostatic hypotension.	Tabara Y, etal., J Hypertens. 2002 Apr;20(4):651-6.
20.	Associations of a human G protein beta3 subunit dimorphism with insulin resistance and carotid atherosclerosis.	Wascher TC, etal., Stroke. 2003 Mar;34(3):605-9. Epub 2003 Feb 20.

Additional References at PubMed

PMID:12454992	PMID:12477932	PMID:15489334	PMID:19255495	PMID:23533145	PMID:25931508	PMID:29206867	PMID:29476059

Genomics

Comparative Map Data

Gnb3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	159,325,741 - 159,331,443 (-)	NCBI		GRCr8
mRatBN7.2	4	157,639,468 - 157,645,171 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	157,639,469 - 157,645,173 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	163,867,751 - 163,873,454 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	159,650,661 - 159,656,363 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	158,286,144 - 158,291,844 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	157,352,558 - 157,359,237 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	157,352,372 - 157,358,262 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	224,370,234 - 224,376,918 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	160,957,524 - 160,963,226 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	161,202,460 - 161,208,162 (-)	NCBI
Celera	4	146,377,383 - 146,383,085 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

GNB3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	6,840,925 - 6,847,393 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	6,839,954 - 6,847,393 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	6,950,089 - 6,956,557 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	6,819,636 - 6,826,818 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	6,819,635 - 6,826,818	NCBI
Celera	12	8,566,659 - 8,573,841 (+)	NCBI		Celera
Cytogenetic Map	12	p13.31	NCBI
HuRef	12	6,803,098 - 6,810,284 (+)	NCBI		HuRef
CHM1_1	12	6,948,373 - 6,955,555 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	6,850,217 - 6,856,691 (+)	NCBI		T2T-CHM13v2.0

Gnb3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	124,811,203 - 124,817,238 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	124,811,203 - 124,817,238 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	124,834,240 - 124,840,275 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	124,834,240 - 124,840,275 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	124,784,258 - 124,790,293 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	124,799,859 - 124,805,894 (-)	NCBI		MGSCv36	mm8
Celera	6	126,510,369 - 126,516,404 (-)	NCBI		Celera
Cytogenetic Map	6	F2	NCBI
cM Map	6	59.17	NCBI

Gnb3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	4,440,693 - 4,447,416 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	4,440,693 - 4,447,419 (+)	NCBI	ChiLan1.0	ChiLan1.0

GNB3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	12,403,159 - 12,410,535 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	12,399,910 - 12,407,293 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	6,971,854 - 6,979,214 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	6,883,280 - 6,890,692 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	6,883,280 - 6,890,692 (+)	Ensembl	panpan1.1		panPan2

GNB3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	38,175,928 - 38,182,473 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	38,175,931 - 38,181,763 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	8,434,984 - 8,440,816 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	38,528,834 - 38,535,384 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	38,528,834 - 38,534,666 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	38,402,886 - 38,408,718 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	38,443,911 - 38,449,741 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	7,913,716 - 7,919,548 (+)	NCBI		UU_Cfam_GSD_1.0

Gnb3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	102,302,620 - 102,309,507 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936709	970,172 - 976,863 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936709	970,169 - 977,059 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNB3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	63,863,661 - 63,870,433 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	63,863,656 - 63,871,352 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	66,299,162 - 66,306,064 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNB3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	6,873,043 - 6,880,676 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	6,874,351 - 6,880,179 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666063	1,342,884 - 1,350,505 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gnb3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624860	3,509,397 - 3,515,352 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624860	3,509,185 - 3,515,025 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gnb3
22 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	198
Count of miRNA genes:	127
Interacting mature miRNAs:	138
Transcripts:	ENSRNOT00000021481
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	146565735	175236377	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	147278504	167139601	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	148090542	168069246	Rat
1581574	Eae20	Experimental allergic encephalomyelitis QTL 20	7.8		nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	153031106	158841762	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	155561574	182687754	Rat

Markers in Region

RH131999

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	157,639,507 - 157,639,695 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	157,352,598 - 157,352,785	NCBI	Rnor6.0
Rnor_5.0	4	224,370,274 - 224,370,461	UniSTS	Rnor5.0
RGSC_v3.4	4	160,957,564 - 160,957,751	UniSTS	RGSC3.4
Celera	4	146,377,423 - 146,377,610	UniSTS
RH 3.4 Map	4	1005.8	UniSTS
Cytogenetic Map	4	q42	UniSTS

RH136873

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	157,646,252 - 157,646,441 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	157,359,342 - 157,359,530	NCBI	Rnor6.0
Rnor_5.0	4	224,377,018 - 224,377,206	UniSTS	Rnor5.0
RGSC_v3.4	4	160,964,308 - 160,964,496	UniSTS	RGSC3.4
Celera	4	146,384,167 - 146,384,355	UniSTS
RH 3.4 Map	4	1004.3	UniSTS
Cytogenetic Map	4	q42	UniSTS

MARC_10541-10542:1000149110:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	157,642,135 - 157,642,688 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	157,355,225 - 157,355,777	NCBI	Rnor6.0
Rnor_5.0	4	224,372,901 - 224,373,453	UniSTS	Rnor5.0
RGSC_v3.4	4	160,960,191 - 160,960,743	UniSTS	RGSC3.4
Celera	4	146,380,050 - 146,380,602	UniSTS
Cytogenetic Map	4	q42	UniSTS

Genetic Models

This gene Gnb3 is modified in the following models/strains:

SS-Gnb3^em1Mcwi

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		23							2
Low	3	20	22	6	19	6	3	5	72	25	37	11	3
Below cutoff			33	33		33	5	6		10	2		5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006237383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC115420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L29090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OU667102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021481 ⟹ ENSRNOP00000021480

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	157,639,469 - 157,645,173 (-)	Ensembl
Rnor_6.0 Ensembl	4	157,352,559 - 157,358,262 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000090898 ⟹ ENSRNOP00000069551

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	157,352,372 - 157,358,007 (-)	Ensembl

RefSeq Acc Id:

NM_021858 ⟹ NP_068630

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	159,325,741 - 159,331,443 (-)	NCBI
mRatBN7.2	4	157,639,468 - 157,645,171 (-)	NCBI
Rnor_6.0	4	157,352,558 - 157,358,260 (-)	NCBI
Rnor_5.0	4	224,370,234 - 224,376,918 (-)	NCBI
RGSC_v3.4	4	160,957,524 - 160,963,226 (-)	RGD
Celera	4	146,377,383 - 146,383,085 (-)	RGD

Sequence:

show sequence

GTGACAGGCAGGCATCACAGCTGAGACCGTGAGGAGGCGCCTGGGAAGCGGAAACCTGGGAGAA
ATCCAGCTAGAGCCCAAGAGCCAGGACTACCCCTCGACCTGTGAACCATGGGGGAGATGGAGCA
GCTGAAGCAGGAGGCGGAGCAGCTCAAGAAGCAGATTGCTGATGCCAGGAAAGCCTGTGCGGAC
ATCACTCTGGCTGAGCTTGTGTCTGGCCTGGAGGTGGTGGGACGAGTCCAGATGCGGACACGGA
GGACGTTAAGGGGACACCTGGCTAAGATCTATGCCATGCACTGGGCCACTGACTCTAAGCTGCT
AGTAAGTGCCTCGCAGGATGGGAAGCTGATCGTGTGGGACACTTACACCACCAATAAGGTGCAT
GCTATCCCGCTGCGTTCCTCCTGGGTCATGACCTGTGCCTATGCACCATCAGGGAACTTCGTGG
CATGTGGGGGGCTAGATAACATGTGCTCAATCTACAGCCTCAAATCCCGTGAGGGCAATGTCAA
GGTCAGCCGGGAACTCTCGGCTCACACAGGTTATCTCTCCTGTTGCCGCTTCCTGGATGACAAC
AACATTGTGACTAGCTCTGGGGACACCACGTGTGCCTTGTGGGACATTGAGACGGGGCAGCAGA
AGACAGTGTTCGTGGGACACACTGGTGACTGCATGAGCCTGGCTGTGTCCCCAGACTACAAACT
CTTCATCTCGGGAGCTTGTGATGCCAGCGCCAAGCTCTGGGATGTGAGGGAAGGGACCTGTCGC
CAGACTTTCACTGGCCACGAGTCAGACATCAATGCTATCTGTTTCTTTCCCAATGGGGAGGCCA
TCTGCACTGGCTCAGATGATGCCTCCTGCCGCCTCTTTGACCTGAGGGCAGACCAGGAACTGAC
AGCCTACTCCCACGAGAGCATCATCTGTGGCATCACGTCCGTAGCCTTCTCACTCAGTGGTCGC
CTGCTCTTTGCTGGCTATGATGACTTCAACTGCAATGTCTGGGACTCTCTGAAGTGTGAGCGTG
TAGGCGTTCTTTCTGGCCATGACAACAGAGTCAGTTGCCTGGGGGTCACAGCTGACGGCATGGC
TGTGGCCACTGGATCCTGGGACAGCTTCCTCAAGATCTGGAACTGAGGAGGCTGGAGGAAGAGG
TGGGAAGCCATGAAGGCTCTCAGCTGACTCCTATGCCCTGTCTCCTTAGGGTCAGTCTTCTATA
CCCTGGGGCCACTCCCAGTAAACTTCCTTCTAAGGGCAGGTGGGATTATGGGAGTGTGCCTTTG
GGAGTAGCAGGGACACAAGGGCAAAGAACTGCCCCATTTCCTCCAGGGCCTCTCCTCTCCACAG
TCCTCATAGCTTCTCCCTTCATAAACAAGAACAGACCCTCCCCATCCTAGATGACTCCTGGGCT
ACCAGCAGCCTTTGTCTGGCCTGGGAATGGCCAGAGCGCTCAGCCCATGACTATAGGTGTCACT
CCTAGTATCCTGGCTCCCTCCCAGCCACTTTCTTTCTGCCCTTTTGTTCTCTCTTATTACCTAA
TAAAATGTAGCATCCTGGTAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_068630	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA62620	(Get FASTA)	NCBI Sequence Viewer
	AAH86422	(Get FASTA)	NCBI Sequence Viewer
	AAZ23826	(Get FASTA)	NCBI Sequence Viewer
	AAZ23827	(Get FASTA)	NCBI Sequence Viewer
	CAG9553620	(Get FASTA)	NCBI Sequence Viewer
	EDM01917	(Get FASTA)	NCBI Sequence Viewer
	EDM01918	(Get FASTA)	NCBI Sequence Viewer
	EDM01919	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021480
	ENSRNOP00000021480.3
	ENSRNOP00055014506
	ENSRNOP00060046618
	ENSRNOP00065041965
GenBank Protein	P52287	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_068630 ⟸ NM_021858

- UniProtKB:

P52287 (UniProtKB/Swiss-Prot), A6ILM1 (UniProtKB/TrEMBL), Q45QL4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGEMEQLKQEAEQLKKQIADARKACADITLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWA
TDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYSLKS
REGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAV
SPDYKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLR
ADQELTAYSHESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSLKCERVGVLSGHDNRVSCLGV
TADGMAVATGSWDSFLKIWN

hide sequence

RefSeq Acc Id:

ENSRNOP00000021480 ⟸ ENSRNOT00000021481

RefSeq Acc Id:

ENSRNOP00000069551 ⟸ ENSRNOT00000090898

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P52287-F1-model_v2	AlphaFold	P52287	1-340	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693392

Promoter ID:

EPDNEW_R3917

Type:

single initiation site

Name:

Gnb3_1

Description:

G protein subunit beta 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	157,358,239 - 157,358,299	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708344	AgrOrtholog
BioCyc Gene	G2FUF-43063	BioCyc
Ensembl Genes	ENSRNOG00000015541	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055010666	UniProtKB/Swiss-Prot
	ENSRNOG00060032557	UniProtKB/Swiss-Prot
	ENSRNOG00065029545	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000021481	ENTREZGENE
	ENSRNOT00000021481.5	UniProtKB/Swiss-Prot
	ENSRNOT00055018063	UniProtKB/Swiss-Prot
	ENSRNOT00060056416	UniProtKB/Swiss-Prot
	ENSRNOT00065051019	UniProtKB/Swiss-Prot
Gene3D-CATH	2.130.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7193131	IMAGE-MGC_LOAD
InterPro	G-protein_beta_WD-40_rep	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Gprotein_B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Guanine_nucleotide-bd_bsu	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40/YVTN_repeat-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:60449	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105437	IMAGE-MGC_LOAD
NCBI Gene	60449	ENTREZGENE
PANTHER	GUANINE NUCLEOTIDE-BINDING PROTEIN G(I)/G(S)/G(T) SUBUNIT BETA-3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR19850	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	WD40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	GNB3	RGD
PhenoGen	Gnb3	PhenoGen
PIRSF	GN-bd_beta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	GPROTEINB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPROTEINBRPT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	WD_REPEATS_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD_REPEATS_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD_REPEATS_REGION	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015541	RatGTEx
	ENSRNOG00055010666	RatGTEx
	ENSRNOG00060032557	RatGTEx
	ENSRNOG00065029545	RatGTEx
SMART	WD40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50978	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6ILM1	ENTREZGENE, UniProtKB/TrEMBL
	A6ILM2_RAT	UniProtKB/TrEMBL
	GBB3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q45QL4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-26	Gnb3	guanine nucleotide binding protein (G protein), beta polypeptide 3	Gnb3	guanine nucleotide binding protein (G protein), beta 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-20	Gnb3	guanine nucleotide binding protein (G protein), beta 3	Gnb3	guanine nucleotide binding protein, beta 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Gnb3	guanine nucleotide binding protein, beta 3	LOC60449	G protein beta-subunit gene	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)