Id4 (inhibitor of DNA binding 4) - Rat Genome Database

Name: Id4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Id4 (inhibitor of DNA binding 4) Rattus norvegicus

Analyze

Symbol:

Id4

Name:

inhibitor of DNA binding 4

RGD ID:

631428

Description:

Predicted to enable RNA polymerase II-specific DNA-binding transcription factor binding activity and transcription regulator inhibitor activity. Predicted to be involved in cell differentiation; circadian regulation of gene expression; and negative regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including central nervous system development; gland morphogenesis; and negative regulation of cell differentiation. Predicted to be located in cytoplasm and nucleoplasm. Predicted to be active in nucleus. Orthologous to human ID4 (inhibitor of DNA binding 4); PARTICIPATES IN transforming growth factor-beta superfamily mediated signaling pathway; INTERACTS WITH 1,3-dinitrobenzene; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DNA-binding protein inhibitor ID-4; Idb4; inhibitor of DNA binding 4, dominant negative helix-loop-helix protein; inhibitor of DNA binding 4, HLH protein

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ID4 (inhibitor of DNA binding 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Id4 (inhibitor of DNA binding 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Id4 (inhibitor of DNA binding 4, HLH protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ID4 (inhibitor of DNA binding 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ID4 (inhibitor of DNA binding 4, HLH protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ID4 (inhibitor of DNA binding 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ID4 (inhibitor of DNA binding 4, HLH protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Id4 (inhibitor of DNA binding 4, HLH protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CXCL2 (C-X-C motif chemokine ligand 2)	HGNC	OMA
Homo sapiens (human):	CXCL1 (C-X-C motif chemokine ligand 1)	HGNC	OMA
Homo sapiens (human):	CXCL3 (C-X-C motif chemokine ligand 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ID4 (inhibitor of DNA binding 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Id4 (inhibitor of DNA binding 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	id4 (inhibitor of DNA binding 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	emc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	id4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	16,595,724 - 16,598,293 (-)	NCBI		GRCr8
mRatBN7.2	17	16,389,387 - 16,391,956 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	16,389,387 - 16,392,470 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	16,269,665 - 16,272,236 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	17,873,494 - 17,876,065 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	16,195,273 - 16,197,843 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	16,692,557 - 16,695,126 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	16,692,557 - 16,695,126 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	18,744,511 - 18,747,080 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	22,525,292 - 22,527,861 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	22,525,291 - 22,527,861 (-)	NCBI
Celera	17	16,113,430 - 16,115,946 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

carcinoma (ISO)

cholestasis (ISO)

Experimental Liver Cirrhosis (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

Neoplasm Invasiveness (ISO)

osteoporosis (ISS)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,3-dinitrobenzene (EXP)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphotericin B (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

avobenzone (ISO)

belinostat (ISO)

benzene (EXP)

benzo[a]pyrene (EXP,ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

cadmium dichloride (EXP,ISO)

captan (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (EXP)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (EXP,ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

diethyl maleate (ISO)

diethylstilbestrol (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

flutamide (EXP)

folpet (ISO)

formaldehyde (ISO)

FR900359 (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

GW 4064 (ISO)

hydroquinone (ISO)

inulin (ISO)

ketoconazole (ISO)

leflunomide (ISO)

lipopolysaccharide (EXP)

mitomycin C (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

nefazodone (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

nimesulide (EXP)

nitrofen (EXP)

ochratoxin A (EXP)

oxaliplatin (EXP)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylephrine (EXP)

phenylmercury acetate (ISO)

PhIP (EXP)

progesterone (ISO)

raloxifene (ISO)

ranitidine (EXP)

resveratrol (EXP)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

succimer (ISO)

sunitinib (ISO)

tacrolimus hydrate (ISO)

tamoxifen (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

torcetrapib (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP,ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (EXP)

triptonide (ISO)

triticonazole (EXP)

troglitazone (EXP)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

astrocyte differentiation (ISO)

brain development (ISO)

cell differentiation (IBA)

cell population proliferation (ISO)

central nervous system myelination (ISO)

cerebral cortex neuron differentiation (ISO)

circadian regulation of gene expression (IBA)

circadian rhythm (ISO)

fat cell differentiation (ISO)

G1/S transition of mitotic cell cycle (ISO)

hippocampus development (ISO)

negative regulation of astrocyte differentiation (ISO)

negative regulation of DNA-templated transcription (ISO)

negative regulation of fat cell differentiation (ISO)

negative regulation of neuron differentiation (ISO)

negative regulation of oligodendrocyte differentiation (ISO)

negative regulation of transcription by RNA polymerase II (IBA,ISO)

neuroblast proliferation (ISO)

neuron differentiation (ISO)

oligodendrocyte differentiation (ISO)

osteoblast differentiation (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of gene expression (ISO)

positive regulation of neuroblast proliferation (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

prostate gland epithelium morphogenesis (ISO)

prostate gland morphogenesis (ISO)

prostate gland stromal morphogenesis (ISO)

protein localization (ISO)

seminal vesicle morphogenesis (ISO)

Cellular Component

cytoplasm (ISO)

nucleoplasm (ISO)

nucleus (IBA,ISO)

Molecular Function

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II-specific DNA-binding transcription factor binding (ISO)

transcription regulator inhibitor activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Id4 regulates mammary epithelial cell growth and differentiation and is overexpressed in rat mammary gland carcinomas.	Shan L, etal., Am J Pathol 2003 Dec;163(6):2495-502.

Additional References at PubMed

PMID:9418957	PMID:11136250	PMID:15469968	PMID:15882580	PMID:16304207	PMID:16862533	PMID:18498089	PMID:19217292	PMID:20460371	PMID:20628571	PMID:21132377	PMID:21543770
PMID:22041901	PMID:23786676	PMID:28278052

Genomics

Comparative Map Data

Id4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	16,595,724 - 16,598,293 (-)	NCBI		GRCr8
mRatBN7.2	17	16,389,387 - 16,391,956 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	16,389,387 - 16,392,470 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	16,269,665 - 16,272,236 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	17,873,494 - 17,876,065 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	16,195,273 - 16,197,843 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	16,692,557 - 16,695,126 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	16,692,557 - 16,695,126 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	18,744,511 - 18,747,080 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	22,525,292 - 22,527,861 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	22,525,291 - 22,527,861 (-)	NCBI
Celera	17	16,113,430 - 16,115,946 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

ID4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	19,837,370 - 19,842,197 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	19,837,370 - 19,842,197 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	19,837,601 - 19,842,428 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	19,945,596 - 19,948,894 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	19,945,595 - 19,948,893	NCBI
Celera	6	21,070,861 - 21,074,159 (+)	NCBI		Celera
Cytogenetic Map	6	p22.3	NCBI
HuRef	6	19,782,014 - 19,786,844 (+)	NCBI		HuRef
CHM1_1	6	19,839,766 - 19,844,596 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	19,709,014 - 19,713,841 (+)	NCBI		T2T-CHM13v2.0

Id4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	48,414,592 - 48,419,504 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	48,414,704 - 48,419,502 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	48,261,116 - 48,266,028 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	48,261,228 - 48,266,026 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	48,356,796 - 48,359,405 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	48,273,364 - 48,275,973 (+)	NCBI		MGSCv36	mm8
Celera	13	49,350,381 - 49,353,061 (+)	NCBI		Celera
Cytogenetic Map	13	A5	NCBI
cM Map	13	24.71	NCBI

Id4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955483	6,600,867 - 6,602,564 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955483	6,598,804 - 6,601,496 (-)	NCBI	ChiLan1.0	ChiLan1.0

ID4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	34,476,360 - 34,479,706 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	30,475,737 - 30,479,077 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	19,665,197 - 19,668,517 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

ID4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	18,358,518 - 18,360,767 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	18,357,826 - 18,359,011 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1 Ensembl	35	18,357,826 - 18,359,011 (+)	NCBI	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	18,306,552 - 18,309,524 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	18,464,103 - 18,467,094 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	18,463,709 - 18,465,771 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	18,276,216 - 18,279,196 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	18,339,930 - 18,342,928 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	19,757,627 - 19,760,617 (+)	NCBI		UU_Cfam_GSD_1.0

ID4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	15,281,757 - 15,282,839 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	15,281,535 - 15,284,895 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	16,178,362 - 16,181,445 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ID4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	52,349,908 - 52,353,218 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	52,348,388 - 52,353,281 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	20,104,714 - 20,109,525 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Id4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	6,814,842 - 6,819,578 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624756	6,816,364 - 6,819,144 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Id4
7 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	474
Count of miRNA genes:	247
Interacting mature miRNAs:	303
Transcripts:	ENSRNOT00000021550
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22871563	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31701463	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	1	31990913	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2115149	21881669	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2115149	34551001	Rat
631499	Stl1	Serum triglyceride level QTL 1	3.6		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	3271398	27389946	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	17	4299130	21293263	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	4299130	21293263	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4354487	27028127	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4354487	27028127	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9201365	23653323	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9201365	23653323	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9201365	23653323	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9991286	40540197	Rat
1549900	Iddm20	Insulin dependent diabetes mellitus QTL 20	3.7		pancreas integrity trait (VT:0010560)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	17	13986773	21975515	Rat
1331720	Rf43	Renal function QTL 43	2.881		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	17	15330613	23017269	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat

Markers in Region

RH144051

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	16,390,592 - 16,390,740 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	16,693,763 - 16,693,910	NCBI	Rnor6.0
Rnor_5.0	17	18,745,717 - 18,745,864	UniSTS	Rnor5.0
RGSC_v3.4	17	22,526,498 - 22,526,645	UniSTS	RGSC3.4
Celera	17	16,114,636 - 16,114,783	UniSTS
RH 3.4 Map	17	181.3	UniSTS
Cytogenetic Map	17	p14	UniSTS

BE116739

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	16,389,909 - 16,390,085 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	16,693,080 - 16,693,255	NCBI	Rnor6.0
Rnor_5.0	17	18,745,034 - 18,745,209	UniSTS	Rnor5.0
RGSC_v3.4	17	22,525,815 - 22,525,990	UniSTS	RGSC3.4
Celera	17	16,113,953 - 16,114,128	UniSTS
RH 3.4 Map	17	184.2	UniSTS
Cytogenetic Map	17	p14	UniSTS

PMC133998P7

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	16,391,146 - 16,391,956 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	16,694,317 - 16,695,126	NCBI	Rnor6.0
Rnor_5.0	17	18,746,271 - 18,747,080	UniSTS	Rnor5.0
RGSC_v3.4	17	22,527,052 - 22,527,861	UniSTS	RGSC3.4
Cytogenetic Map	17	p14	UniSTS

Idb4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	16,390,494 - 16,391,962 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	16,693,665 - 16,695,132	NCBI	Rnor6.0
Rnor_5.0	17	18,745,619 - 18,747,086	UniSTS	Rnor5.0
RGSC_v3.4	17	22,526,400 - 22,527,867	UniSTS	RGSC3.4
Celera	17	16,115,188 - 16,115,803	UniSTS
Cytogenetic Map	17	p14	UniSTS

Idb4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	16,391,144 - 16,391,760 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	16,694,315 - 16,694,930	NCBI	Rnor6.0
Rnor_5.0	17	18,746,269 - 18,746,884	UniSTS	Rnor5.0
RGSC_v3.4	17	22,527,050 - 22,527,665	UniSTS	RGSC3.4
Celera	17	16,115,188 - 16,115,803	UniSTS
Cytogenetic Map	17	p14	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	4	16	16	2	16			74	35	34	11
Low		39	39	23	17	23	8	11			7		8
Below cutoff			2	2		2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_175582	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF468681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021550 ⟹ ENSRNOP00000021550

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	16,389,387 - 16,392,470 (-)	Ensembl
Rnor_6.0 Ensembl	17	16,692,557 - 16,695,126 (-)	Ensembl

RefSeq Acc Id:

NM_175582 ⟹ NP_783172

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	16,595,724 - 16,598,293 (-)	NCBI
mRatBN7.2	17	16,389,387 - 16,391,956 (-)	NCBI
Rnor_6.0	17	16,692,557 - 16,695,126 (-)	NCBI
Rnor_5.0	17	18,744,511 - 18,747,080 (-)	NCBI
RGSC_v3.4	17	22,525,292 - 22,527,861 (-)	RGD
Celera	17	16,113,430 - 16,115,946 (-)	RGD

Sequence:

show sequence

ATGAAGGCGGTGAGCCCGGTGCGCCCCTCTGGCCGCAAGGCGCCGTCGGGCTGCGGCGGCGGGG
AGCTGGCGCTACGTTGCCTGGCGGAGCATGGCCATAGCCTAGGTGGCTCGGCAGCCGCGGCGGC
GGCGGCGGCGGCAGCGCGCTGCAAGGCGGCCGAGGCGGCGGCCGACGAGCCGGCACTGTGCCTG
CAGTGCGATATGAACGACTGCTACACTCGCCTGCGGAGGCTCGTGCCCACCATCCCGCCCAACA
AGAAAGTCAGCAAAGTGGAGATCCTGCAGCACGTTATCGACTACATCCTGGACCTGCAGCTGGC
GCTGGAGACGCACCCTGCTCTGCTGAGACAGCCGCCACCGCCCGCGCCACCGCTCCACTCGGCC
GGGGCTTGCCCGGTCGCGTCGCAGCGGACCCCGCTTACGGCGCTCAACACTGACCCGGCCGGCG
CCGTGAACAAGCAGGGCGACAGCATTCTCTGCCGCTGAGCTGCGTTGGCCAGGTGTGCGGCCGC
CTGAGCACCAGCGAGCCAGGAGCCCTAGAAAGGGAGGGCCAGAGCAGAAATTAAGAGAAAAAAG
CCACCAGAGGAAAGGAAAAAAAAATCTTCAGCAAATCTAGAAACGTTGTCTCGGCTTGTCATTC
CAAGAGAGAGAGAGAAAGAAGGGGAAAAATAATAAAACTTAAATTCACTTTTACTTTTTTGCAC
GTTCACAAGCATTCACCGTACGTATTCTCTTTTAGTTTTTTTTTTTCTTTTATAACCGCTGTGA
ATTGTACATTTCTGTGGTTATTTTTATCACCCTTTTGGAGATGCAGTTAAACTTTGAAGCTTAA
GTGTGACCAGACTGTAAGCGGAAGAGCTATAGTGAATCCAACTTTAGAGGTTACGTTGTGACAA
GCGAACTGTTTTTGTTTCTGAAGCTTTACTAATATACCAGAGCATTGGCGACGTTGTTTTACAT
CTGTTGTTTAAAATAGATGATTATAACAGGGCGGGGAACTTTTTCTCTGCAAGAATGTTACATA
TTGTACAGATAAGTGAGTGACATTTCATACCCTGTATATATAGAGATGTTCTATAAGTGTGAGA
AAGTATATGCGCTTTAATAGACTACTGTAATTATAAGATATTTTTAATTAAATATTTTTTGTAA
ATATTATGTGTGTGTTTTTTTAAATCTATGGGAATATTTCTTTTGGAAAATTATTTTTCAGCTC
CATGGCAGAGCTCTTAAAATCTATCTGGATGTTTTCTGTTTGGCCAAGCTGTTTGATTTGTTTT
GTTGTTTTGCCCAGTATCTAGTATCTGAGGCTCAGAAGTAACAGCTCTCTGGTACTGGTTTGCA
TGATTGCATGAGATGTTCAATCACAAAATAAACCCGTTATGAGTCCTTTCAAATGTGCTTTCCT
GACCTAGATGGGAACCTTTGTATTTGAAGTGTACATGTTGAAAACATACCTTATCCGGGTTTAA
GTACAGGGGTTTATAGTGTAATATATAAAGAATTAAGTGCGTGAGGGGTTTTTTTTTTTCCCTT
TTGAACTGAGGGCCAAAATAAAATGGGGGGAATTTGCATATAGGATGGGGAAATACTTGGGACC
TTTAAGGAGTCTACAGAACTGCTGTCTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_783172	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAO15695	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021550
	ENSRNOP00000021550.2

RefSeq Acc Id:	NP_783172 ⟸ NM_175582
- UniProtKB:	E9PU21 (UniProtKB/TrEMBL), Q8CH17 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCL QCDMNDCYTRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPLHSA GACPVASQRTPLTALNTDPAGAVNKQGDSILCR hide sequence

RefSeq Acc Id:

ENSRNOP00000021550 ⟸ ENSRNOT00000021550

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PU21-F1-model_v2	AlphaFold	E9PU21	1-161	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:631428	AgrOrtholog
BioCyc Gene	G2FUF-9952	BioCyc
Ensembl Genes	ENSRNOG00000016099	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021550	ENTREZGENE
	ENSRNOT00000021550.3	UniProtKB/TrEMBL
Gene3D-CATH	4.10.280.10	UniProtKB/TrEMBL
InterPro	DNA-bd_prot-inh	UniProtKB/TrEMBL
	HLH_DNA-bd	UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:291023	UniProtKB/TrEMBL
NCBI Gene	291023	ENTREZGENE
PANTHER	DNA-BINDING PROTEIN INHIBITOR ID-4	UniProtKB/TrEMBL
	PTHR11723	UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/TrEMBL
PhenoGen	Id4	PhenoGen
PROSITE	HLH	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016099	RatGTEx
SMART	HLH	UniProtKB/TrEMBL
Superfamily-SCOP	HLH_basic	UniProtKB/TrEMBL
UniProt	E9PU21	ENTREZGENE, UniProtKB/TrEMBL
	Q8CH17	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-10-13	Id4	inhibitor of DNA binding 4	Id4	inhibitor of DNA binding 4, HLH protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-15	Id4	inhibitor of DNA binding 4, HLH protein	Id4	inhibitor of DNA binding 4, dominant negative helix-loop-helix protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-25	Id4	inhibitor of DNA binding 4, dominant negative helix-loop-helix protein	Id4	inhibitor of DNA binding 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Id4	inhibitor of DNA binding 4	Idb4		Symbol updated	1299863	APPROVED
2004-02-11	Idb4	inhibitor of DNA binding 4			Symbol and Name status set to approved	625702	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)