Miox (myo-inositol oxygenase) - Rat Genome Database

Name: Miox
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Miox (myo-inositol oxygenase) Rattus norvegicus

Analyze

Symbol:

Miox

Name:

myo-inositol oxygenase

RGD ID:

628739

Description:

Enables NADP binding activity. Predicted to be involved in inositol catabolic process. Predicted to be located in cytoplasm and inclusion body. Orthologous to human MIOX (myo-inositol oxygenase); PARTICIPATES IN inositol metabolic pathway; ascorbate and aldarate metabolic pathway; inositol phosphate metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

aldehyde reductase (aldose reductase) like 6; aldehyde reductase-like 6; Aldrl6; inositol oxygenase; kidney-specific protein 32; MI oxygenase; renal-specific oxido-reductase; renal-specific oxidoreductase; RSOR

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MIOX (myo-inositol oxygenase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Miox (myo-inositol oxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Miox (myo-inositol oxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MIOX (myo-inositol oxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MIOX (myo-inositol oxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Miox (myo-inositol oxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MIOX (myo-inositol oxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MIOX (myo-inositol oxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TSPAN32 (tetraspanin 32)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MIOX (myo-inositol oxygenase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Miox (myo-inositol oxygenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	miox (myo-inositol oxygenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C54E4.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6910	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	miox	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	122,284,660 - 122,287,158 (+)	NCBI		GRCr8
mRatBN7.2	7	120,405,031 - 120,407,529 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	120,405,031 - 120,407,537 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	122,155,669 - 122,158,167 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	124,381,826 - 124,384,324 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	124,344,535 - 124,347,033 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	130,308,707 - 130,311,205 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	130,308,532 - 130,313,727 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	129,994,009 - 129,996,507 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	127,632,433 - 127,634,931 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	127,666,662 - 127,669,160 (+)	NCBI
Celera	7	116,878,837 - 116,881,335 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

chromosome 22q13 duplication syndrome (ISO)

congenital disorder of glycosylation Ig (ISO)

genetic disease (ISO)

intellectual disability (ISO)

megaconial type congenital muscular dystrophy (ISO)

metachromatic leukodystrophy (ISO)

Phelan-McDermid syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (EXP)

acetamide (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

carbon nanotube (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

dextran sulfate (ISO)

dibutyl phthalate (ISO)

diethylstilbestrol (EXP)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

glafenine (EXP)

GW 4064 (ISO)

inositol (ISO)

iron atom (ISO)

iron(0) (ISO)

L-methionine (ISO)

lead diacetate (EXP,ISO)

mono(2-ethylhexyl) phthalate (ISO)

Muraglitazar (EXP)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-nitrosodiethylamine (ISO)

nefazodone (EXP)

ochratoxin A (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (EXP,ISO)

pravastatin (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propanal (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

tebuconazole (ISO)

Tesaglitazar (EXP)

tetrachloroethene (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

troglitazone (EXP)

valproic acid (ISO)

vancomycin (ISO)

zaragozic acid A (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

inositol catabolic process (IBA,IEA,ISO,ISS)

Cellular Component

cytoplasm (IEA,ISO,ISS)

inclusion body (ISO,ISS)

Molecular Function

aldo-keto reductase (NADPH) activity (IEA,ISO,ISS)

ferric iron binding (IEA,ISO,ISS)

inositol oxygenase activity (IBA,IEA,ISO,ISS)

iron ion binding (IEA)

NADP binding (IDA)

oxidoreductase activity, acting on NAD(P)H (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ascorbate and aldarate metabolic pathway (IEA)

inositol metabolic pathway (ISO)

inositol phosphate metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Identification of a renal-specific oxido-reductase in newborn diabetic mice.	Yang Q, etal., Proc Natl Acad Sci U S A 2000 Aug 29;97(18):9896-901.

Additional References at PubMed

PMID:11716759	PMID:12477932	PMID:15489334	PMID:15504367	PMID:18364358	PMID:19053028	PMID:23376485	PMID:26578517

Genomics

Comparative Map Data

Miox
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	122,284,660 - 122,287,158 (+)	NCBI		GRCr8
mRatBN7.2	7	120,405,031 - 120,407,529 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	120,405,031 - 120,407,537 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	122,155,669 - 122,158,167 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	124,381,826 - 124,384,324 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	124,344,535 - 124,347,033 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	130,308,707 - 130,311,205 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	130,308,532 - 130,313,727 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	129,994,009 - 129,996,507 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	127,632,433 - 127,634,931 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	127,666,662 - 127,669,160 (+)	NCBI
Celera	7	116,878,837 - 116,881,335 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

MIOX
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	50,486,859 - 50,490,648 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	50,486,784 - 50,490,648 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	50,925,288 - 50,929,077 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	49,272,079 - 49,275,616 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	49,215,356 - 49,218,894	NCBI
Celera	22	34,801,247 - 34,804,784 (+)	NCBI		Celera
Cytogenetic Map	22	q13.33	NCBI
HuRef	22	33,815,598 - 33,819,135 (+)	NCBI		HuRef
CHM1_1	22	50,883,973 - 50,887,497 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	50,996,041 - 50,999,830 (+)	NCBI		T2T-CHM13v2.0

Miox
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	89,218,676 - 89,221,210 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	89,218,601 - 89,221,218 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	89,334,473 - 89,337,007 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	89,334,398 - 89,337,015 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	89,164,904 - 89,167,438 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	89,162,240 - 89,164,774 (+)	NCBI		MGSCv36	mm8
Celera	15	91,463,588 - 91,466,122 (+)	NCBI		Celera
Cytogenetic Map	15	E3	NCBI
cM Map	15	44.82	NCBI

Miox
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	33,476,033 - 33,478,539 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	33,476,097 - 33,478,539 (+)	NCBI	ChiLan1.0	ChiLan1.0

MIOX
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	60,408,528 - 60,412,631 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	63,099,540 - 63,105,092 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	30,735,206 - 30,738,738 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	49,720,339 - 49,724,370 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	49,720,339 - 49,724,370 (+)	Ensembl	panpan1.1		panPan2

MIOX
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	16,813,532 - 16,815,930 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	16,813,545 - 16,818,015 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	16,790,954 - 16,795,346 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	17,539,689 - 17,542,009 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	17,539,608 - 17,544,075 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	17,263,991 - 17,268,383 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	17,587,203 - 17,591,592 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	17,719,250 - 17,723,642 (-)	NCBI		UU_Cfam_GSD_1.0

Miox
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	355,356 - 357,742 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936629	355,362 - 357,697 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936629	355,517 - 357,678 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MIOX
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	248,235 - 251,553 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	249,312 - 251,547 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	110,529,984 - 110,532,905 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MIOX
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	32,953,268 - 32,960,123 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	32,957,256 - 32,961,023 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	92,380,757 - 92,383,861 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Miox
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	41
Count of miRNA genes:	38
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000011941
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	112308254	133492884	Rat
1357339	Stl14	Serum triglyceride level QTL 14	3.45	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	112729683	133492707	Rat
1582240	Sffal1	Serum free fatty acids level QTL 1	3.4	0.0021	blood free fatty acid amount (VT:0001553)	serum free fatty acids level (CMO:0000547)	7	116677010	124049952	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	116677189	127103496	Rat
1354582	Stl11	Serum triglyceride level QTL 11	3.42		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	119513385	135012528	Rat

Markers in Region

AW108536

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	120,406,767 - 120,406,979 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	130,310,444 - 130,310,655	NCBI	Rnor6.0
Rnor_5.0	7	129,995,746 - 129,995,957	UniSTS	Rnor5.0
RGSC_v3.4	7	127,634,170 - 127,634,381	UniSTS	RGSC3.4
Celera	7	116,880,574 - 116,880,785	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH131425

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High										3
Medium			17	17		17				24
Low	3	9	40	24	19	24	8	8	9	4	19	10	8
Below cutoff		6						3	4	2	14	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_145771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC125982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF197128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF230096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY738259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000011941 ⟹ ENSRNOP00000011941

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	120,405,031 - 120,407,528 (+)	Ensembl
Rnor_6.0 Ensembl	7	130,308,532 - 130,313,727 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000119874 ⟹ ENSRNOP00000087792

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	120,405,507 - 120,407,537 (+)	Ensembl

RefSeq Acc Id:

NM_145771 ⟹ NP_665714

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	122,284,660 - 122,287,158 (+)	NCBI
mRatBN7.2	7	120,405,031 - 120,407,529 (+)	NCBI
Rnor_6.0	7	130,308,707 - 130,311,205 (+)	NCBI
Rnor_5.0	7	129,994,009 - 129,996,507 (+)	NCBI
RGSC_v3.4	7	127,632,433 - 127,634,931 (+)	RGD
Celera	7	116,878,837 - 116,881,335 (+)	RGD

Sequence:

show sequence

CTCAGGATGAAGGTCGACTTGGGCCCAGACCCTTCCCTGGTCTATCGACCTGATGTGGACCCAG
AGATGGCCAAAAGCAAGGGCAGCTTCCGAAACTACACTTCAGGCCCGCTGCTGGATCGCGTCTT
TACCACCTATAAGCTGATGCACACTCACCAGACCGTGGACTTCGTCATGCGGAAGCGCATCCAG
TTTGGAAGCTTCTCTTACAAGAAGATGACGGTCATGGAGGCTGTAGATATGCTGGATGATCTGG
TGGACGAATCTGACCCAGACGTAGACTTCCCCAACTCCTTTCACGCGTTCCAGACCGCGGAGGG
CATCCGAAAAGCCCACCCAGACAAGGACTGGTTCCATCTGGTTGGACTTTTGCATGATCTGGGG
AAAATCCTGGCCCTGTGGGGGGAACCTCAGTGGGCTGTTGTTGGAGACACTTTCCCCGTGGGCT
GCCGTCCCCAGGCCTCCGTGGTGTTCTGCGACTCTACTTTCCAGGACAATCCTGACCTCCAGGA
CCCTCGATACAGCACAGAACTTGGCATGTACCAGCCCCACTGTGGACTTGAGAATGTCCTTATG
TCCTGGGGCCATGATGAGTACCTATACCAGATGATGAAGTTCAACAAGTTCTCCCTACCTTCAG
AGGCCTTCTACATGGTCCGATTCCATTCCTTCTATCCGTGGCACACCGGCGGTGACTACCGGCA
GCTGTGCAGTCAGCAAGACCTGGATATGCTGCCTTGGGTGCAAGAGTTCAACAAGTTTGACCTC
TACACCAAGTGCCCTGACCTACCGGAAGTGAAGAGCCTGCGGCCCTACTATCAGGGGCTGATTG
ACAAGTACTGCCCGGGCATCCTGAGCTGGTGAATGGTTTCTAATACCTTCTCTCTCACTGCTGA
GGGGCACCAAGGCTGGACAACTTCAGGGACAATAATAGCCCATGCCACCTGTCCACAGTCCCCA
CCCATCACAGTTGAGGTCACTTTTGCCTGGCTATCAATAAAGCATAAAAGAGATTAAAAAAAAA
AAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_665714	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF25203	(Get FASTA)	NCBI Sequence Viewer
	AAH78840	(Get FASTA)	NCBI Sequence Viewer
	AAK00767	(Get FASTA)	NCBI Sequence Viewer
	AAV65817	(Get FASTA)	NCBI Sequence Viewer
	EDL76557	(Get FASTA)	NCBI Sequence Viewer
	EDL76558	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011941
	ENSRNOP00000011941.5
	ENSRNOP00000087792.1
	ENSRNOP00055016541
	ENSRNOP00060040978
	ENSRNOP00065022507
GenBank Protein	Q9QXN4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_665714 ⟸ NM_145771

- UniProtKB:

Q68G06 (UniProtKB/Swiss-Prot), Q5S8C8 (UniProtKB/Swiss-Prot), Q99PN7 (UniProtKB/Swiss-Prot), Q9QXN4 (UniProtKB/Swiss-Prot), A6K7L4 (UniProtKB/TrEMBL), A0A0H2UHH0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKVDLGPDPSLVYRPDVDPEMAKSKGSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVMRKRIQFG
SFSYKKMTVMEAVDMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKI
LALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSW
GHDEYLYQMMKFNKFSLPSEAFYMVRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYT
KCPDLPEVKSLRPYYQGLIDKYCPGILSW

hide sequence

RefSeq Acc Id:

ENSRNOP00000011941 ⟸ ENSRNOT00000011941

RefSeq Acc Id:

ENSRNOP00000087792 ⟸ ENSRNOT00000119874

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QXN4-F1-model_v2	AlphaFold	Q9QXN4	1-285	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695582

Promoter ID:

EPDNEW_R6107

Type:

multiple initiation site

Name:

Miox_1

Description:

myo-inositol oxygenase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R6108

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	130,308,556 - 130,308,616	EPDNEW

RGD ID:

13695583

Promoter ID:

EPDNEW_R6108

Type:

multiple initiation site

Name:

Miox_2

Description:

myo-inositol oxygenase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R6107

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	130,308,688 - 130,308,748	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628739	AgrOrtholog
BioCyc Gene	G2FUF-32444	BioCyc
Ensembl Genes	ENSRNOG00000008694	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055012081	UniProtKB/Swiss-Prot
	ENSRNOG00060028196	UniProtKB/Swiss-Prot
	ENSRNOG00065017024	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000011941	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000011941.6	UniProtKB/Swiss-Prot
	ENSRNOT00000119874.1	UniProtKB/TrEMBL
	ENSRNOT00055020540	UniProtKB/Swiss-Prot
	ENSRNOT00060049097	UniProtKB/Swiss-Prot
	ENSRNOT00065028450	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7110224	IMAGE-MGC_LOAD
InterPro	Aldo/ket_reductase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Inositol_oxygenase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:252899	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93474	IMAGE-MGC_LOAD
NCBI Gene	252899	ENTREZGENE
PANTHER	INOSITOL OXYGENASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12588	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	MIOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Miox	PhenoGen
PROSITE	ALDOKETO_REDUCTASE_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008694	RatGTEx
	ENSRNOG00055012081	RatGTEx
	ENSRNOG00060028196	RatGTEx
	ENSRNOG00065017024	RatGTEx
Superfamily-SCOP	HD-domain/PDEase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0H2UHH0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GFH1_RAT	UniProtKB/TrEMBL
	A6K7L4	ENTREZGENE, UniProtKB/TrEMBL
	A6K7L5_RAT	UniProtKB/TrEMBL
	MIOX_RAT	UniProtKB/Swiss-Prot
	Q5S8C8	ENTREZGENE
	Q68G06	ENTREZGENE
	Q99PN7	ENTREZGENE
	Q9QXN4	ENTREZGENE
UniProt Secondary	Q5S8C8	UniProtKB/Swiss-Prot
	Q68G06	UniProtKB/Swiss-Prot
	Q99PN7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-07-11	Miox	myo-inositol oxygenase	Aldrl6	aldehyde reductase (aldose reductase) like 6	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2004-12-14	Aldrl6	aldehyde reductase (aldose reductase) like 6			Symbol and Name status set to approved	1299863	APPROVED
2003-02-27	Aldrl6	aldehyde reductase (aldose reductase) like 6			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in renal proximal tubules	631888
gene_product	member of the aldo-keto reductase family	631888

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)