Gng10 (G protein subunit gamma 10)

Gene: Gng10 (G protein subunit gamma 10) Rattus norvegicus

Analyze

Symbol:

Gng10

Name:

G protein subunit gamma 10

RGD ID:

621514

Description:

Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Part of heterotrimeric G-protein complex. Orthologous to human GNG10 (G protein subunit gamma 10); PARTICIPATES IN chemokine mediated signaling pathway; glutamate signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-methoxyethanol; 6-propyl-2-thiouracil.

Type:

protein-coding (Ensembl: lncRNA)

RefSeq Status:

VALIDATED

Previously known as:

ENSRNOG00000067358; guanine nucleotide binding protein (G protein), gamma 10; guanine nucleotide binding protein 10; guanine nucleotide binding protein gamma 10 subunit; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10; heterotrimeric guanine nucleotide-binding protein 3m1; Hg3m1; MGC124511

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNG10 (G protein subunit gamma 10)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gng10 (guanine nucleotide binding protein (G protein), gamma 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gng10 (G protein subunit gamma 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNG10 (G protein subunit gamma 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNG10 (G protein subunit gamma 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101964645 (guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNG10 (G protein subunit gamma 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNG10 (G protein subunit gamma 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gng10 (G protein subunit gamma 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Gng10 (guanine nucleotide binding protein (G protein), gamma 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GNG10 (G protein subunit gamma 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	gng10 (guanine nucleotide binding protein (G protein), gamma 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpc-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ggamma1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG43324	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	gng10	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Gng10-ps1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	78,651,167 - 78,658,060 (+)	NCBI		GRCr8
mRatBN7.2	5	73,856,124 - 73,863,017 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	73,856,000 - 73,864,390 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	5	73,856,164 - 73,863,012 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	75,757,386 - 75,764,290 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	77,579,006 - 77,585,910 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	77,551,158 - 77,558,064 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	76,182,100 - 76,189,014 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	76,182,121 - 76,189,013 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	80,325,898 - 80,332,791 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	77,083,335 - 77,090,218 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	77,092,258 - 77,092,346 (+)	NCBI
Celera	5	72,678,328 - 72,685,217 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methoxyethanol (EXP)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

cannabidiol (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

dibutyl phthalate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (EXP)

flutamide (EXP)

folic acid (ISO)

glycidyl methacrylate (ISO)

glyphosate (ISO)

gold atom (ISO)

gold(0) (ISO)

isobutanol (ISO)

methylmercury chloride (ISO)

nicotine (ISO)

ozone (ISO)

paracetamol (EXP)

perfluorohexanesulfonic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

SB 431542 (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (ISO)

tolcapone (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

tungsten (ISO)

valproic acid (ISO)

vancomycin (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

Cellular Component

heterotrimeric G-protein complex (IDA)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Distribution of heterotrimeric G-protein beta and gamma subunits in the rat brain.	Betty M, etal., Neuroscience 1998 Jul;85(2):475-86.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	Heterotypic tubular connections at the endoplasmic reticulum-Golgi complex interface.	Vivero-Salmeron G, etal., Histochem Cell Biol. 2008 Oct;130(4):709-17. Epub 2008 Jul 22.

Additional References at PubMed

PMID:8889548	PMID:12060780	PMID:12477932	PMID:23376485

Genomics

Comparative Map Data

Gng10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	78,651,167 - 78,658,060 (+)	NCBI		GRCr8
mRatBN7.2	5	73,856,124 - 73,863,017 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	73,856,000 - 73,864,390 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	5	73,856,164 - 73,863,012 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	75,757,386 - 75,764,290 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	77,579,006 - 77,585,910 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	77,551,158 - 77,558,064 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	76,182,100 - 76,189,014 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	76,182,121 - 76,189,013 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	80,325,898 - 80,332,791 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	77,083,335 - 77,090,218 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	77,092,258 - 77,092,346 (+)	NCBI
Celera	5	72,678,328 - 72,685,217 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

GNG10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	111,661,605 - 111,670,226 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	111,661,605 - 111,670,226 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	114,423,885 - 114,432,506 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	113,463,682 - 113,472,347 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	84,922,924 - 84,931,584 (+)	NCBI		Celera
Cytogenetic Map	9	q31.3	NCBI
HuRef	9	84,022,371 - 84,031,039 (+)	NCBI		HuRef
CHM1_1	9	114,570,242 - 114,578,906 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	123,832,965 - 123,841,586 (+)	NCBI		T2T-CHM13v2.0

Gng10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	59,035,156 - 59,041,899 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	59,035,088 - 59,041,903 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	59,035,156 - 59,041,899 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	59,035,088 - 59,041,903 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	59,048,028 - 59,054,771 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	59,129,210 - 59,135,953 (+)	NCBI		MGSCv36	mm8
Celera	4	58,945,401 - 58,952,110 (+)	NCBI		Celera
Cytogenetic Map	4	B3	NCBI
cM Map	4	32.36	NCBI

Gng10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955419	15,650,973 - 15,653,122 (-)	NCBI	ChiLan1.0	ChiLan1.0

GNG10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	27,759,918 - 27,775,260 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	27,762,264 - 27,771,186 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	82,791,821 - 82,800,763 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	110,953,338 - 110,962,288 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

GNG10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	47,283,272 - 47,284,375 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	47,283,272 - 47,284,369 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	64,681,047 - 64,687,575 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	67,403,953 - 67,410,435 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	67,403,989 - 67,409,523 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	65,920,726 - 65,927,265 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	65,944,246 - 65,950,784 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	66,634,242 - 66,640,794 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101964645
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	165,243,555 - 165,244,170 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004937297	89,279 - 90,425 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNG10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	252,453,107 - 252,460,315 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	252,453,009 - 252,459,978 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	283,246,536 - 283,266,474 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNG10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	27,837,287 - 27,846,217 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	27,836,526 - 27,846,207 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666035	14,935,965 - 14,945,093 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gng10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	23,338,452 - 23,345,576 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	23,338,452 - 23,345,602 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gng10
35 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	389
Count of miRNA genes:	228
Interacting mature miRNAs:	261
Transcripts:	ENSRNOT00000020707
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	68984307	104251008	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	68984307	104251008	Rat
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	68984307	104251008	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat

Markers in Region

RH128524

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	73,862,700 - 73,862,917 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	76,188,698 - 76,188,914	NCBI	Rnor6.0
Rnor_5.0	5	80,332,475 - 80,332,691	UniSTS	Rnor5.0
RGSC_v3.4	5	77,089,905 - 77,090,121	UniSTS	RGSC3.4
Celera	5	72,684,901 - 72,685,117	UniSTS
RH 3.4 Map	5	494.7	UniSTS
Cytogenetic Map	5	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	6	7	74	35	37	11	6
Low							2	4			4		2
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF022090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI044970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC105759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF556593	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BG673282	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CA340326	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB326556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB576440	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB616034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120500	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214425	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OU667115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000020707 ⟹ ENSRNOP00000020707

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	73,856,164 - 73,863,012 (-)	Ensembl
Rnor_6.0 Ensembl	5	76,182,121 - 76,189,013 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000098735

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	73,856,548 - 73,863,003 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106979

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	73,856,162 - 73,863,014 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108648

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	73,856,000 - 73,864,390 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109406

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	73,856,969 - 73,863,084 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113699

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	73,856,969 - 73,863,084 (+)	Ensembl

RefSeq Acc Id:

NM_053660 ⟹ NP_446112

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	78,651,167 - 78,658,060 (+)	NCBI
mRatBN7.2	5	73,856,124 - 73,863,017 (+)	NCBI
Rnor_6.0	5	76,182,121 - 76,189,014 (+)	NCBI
Rnor_5.0	5	80,325,898 - 80,332,791 (+)	NCBI
RGSC_v3.4	5	77,083,335 - 77,090,218 (+)	RGD
Celera	5	72,678,328 - 72,685,217 (+)	NCBI

Sequence:

show sequence

GCGGTTCCGCCCAGCCGAGCCCGCTGCTCGCAGCCTTAGTCGCCATGTCTTCCGGGGCCAGCGT
GAGCGCCCTGCAGCGCCTGGTAGAGCAGCTGAAGCTGGAGGCCGGCGTGGAGAGGATCAAGGTC
TCTCAGGCAGCTGCAGAGCTTCAGCAGTACTGCATACAGAATGCATGCAAGGACGCCCTGCTGC
TTGGTGTTCCGGCTGGAAGCAACCCCTTCCGGGAGCCCAGGTCCTGTGCTTTACTTTGAAGACT
GGGAAGAAGCTCTCTGAGGAACCTGTGTGTGCATGGTGATGGATGACTACCGCCAAGTCCCAAG
AAAACAGATTTCAAGAGCCAAATCATTTTCTCTGTGGCCTGGTCCTAGGTCAAAATTCTACAGA
AATCAATGTTTTGTCTTATTTTTTAACCTCATTACCAAACTCACTGGGTGCATCTCTCAGTCAA
GCCTGTGCGGCCCTGCCTGGGATGGAGGCATGTTTTGTTTACTGGGTATTTGCATTTCTGGATG
GAAATGTTGTATTTCCGAAAACTGAGTATTTGTAATTTTCCTAACATTTTTATACTGTAATAAA
AAATTTTCATAAAAATTTACAGTTACTAAATTAGACAAAGTATAAATTGGGGAATGATTGATAT
GCTGGTTTCGTAAAGGAGGCCTTTCCAGTCCCAGTGAGCAAACGGTCTGACCTGGACGGGAAGC
TGGGGAGCCGCTCCTTAGCACACGGAGCATGGATGTGTTGTTAGGTGGCCCTCCCGTGTGAAGC
CATTAGAACTTTCTTTAGTTCCTGTACTCTACAACTTATAATTGTGTCTGATGCTTTGAAAAGT
GTGCTCATGCCTTTAAAAATGTTTAAATGTGATCTACACTTAGAACGTTGCAATTGGTTAAAAA
CAAAATATGAAGATATTATAACCTAAAAGAATTCATGTCACACATATTTTATTGGGGGTGATGT
GCCTTTGATTTAATTGGGGACACTTTTAGAAGGAAAGTTTGTGTTTGTGATTATCTTTGAAGAG
CTTGGAAATAAAATTTTTGCCTAATTCATCATTTTCCATGACAACAGTAAAAAAAAAAAAAAAA
AA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446112	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB82557	(Get FASTA)	NCBI Sequence Viewer
	AAI05760	(Get FASTA)	NCBI Sequence Viewer
	AAZ23838	(Get FASTA)	NCBI Sequence Viewer
	AAZ23839	(Get FASTA)	NCBI Sequence Viewer
	CAG9553633	(Get FASTA)	NCBI Sequence Viewer
	EDL91645	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446112 ⟸ NM_053660
- UniProtKB:	Q3KRE3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSSGASVSALQRLVEQLKLEAGVERIKVSQAAAELQQYCIQNACKDALLLGVPAGSNPFREPRS CALL hide sequence

RefSeq Acc Id:

ENSRNOP00000020707 ⟸ ENSRNOT00000020707

Protein Domains

G protein gamma

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3KRE3-F1-model_v2	AlphaFold	Q3KRE3	1-68	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693770

Promoter ID:

EPDNEW_R4293

Type:

initiation region

Name:

Gng10_1

Description:

G protein subunit gamma 10

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	76,182,158 - 76,182,218	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621514	AgrOrtholog
BioCyc Gene	G2FUF-41161	BioCyc
Ensembl Genes	ENSRNOG00000025040	Ensembl
	ENSRNOG00000067358	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000106979	ENTREZGENE
Gene3D-CATH	4.10.260.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5623275	IMAGE-MGC_LOAD
InterPro	G-protein_gamma-like	UniProtKB/TrEMBL
	GGL_sf	UniProtKB/TrEMBL
	Gprotein-gamma	UniProtKB/TrEMBL
KEGG Report	rno:114119	UniProtKB/TrEMBL
MGC_CLONE	MGC:124511	IMAGE-MGC_LOAD
NCBI Gene	114119	ENTREZGENE
PANTHER	Gprotein-gamma	UniProtKB/TrEMBL
	GUANINE NUCLEOTIDE-BINDING PROTEIN G(I)/G(S)/G(O) SUBUNIT GAMMA-10	UniProtKB/TrEMBL
Pfam	G-gamma	UniProtKB/TrEMBL
PharmGKB	GNG10	RGD
PhenoGen	Gng10	PhenoGen
PRINTS	GPROTEING	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_GAMMA	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000025040	RatGTEx
	ENSRNOG00000067358	RatGTEx
SMART	G_gamma	UniProtKB/TrEMBL
	GGL	UniProtKB/TrEMBL
Superfamily-SCOP	G-protein_gamma-like	UniProtKB/TrEMBL
UniProt	A6KDW0_RAT	UniProtKB/TrEMBL
	Q3KRE3	ENTREZGENE, UniProtKB/TrEMBL
	Q45QK2_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-06-02	Gng10	G protein subunit gamma 10	ENSRNOG00000067358		Data merged from RGD:150340773	737654	PROVISIONAL
2021-08-31	ENSRNOG00000067358				Symbol and Name status set to provisional	45752	PROVISIONAL
2016-03-15	Gng10	G protein subunit gamma 10	Gng10	guanine nucleotide binding protein (G protein), gamma 10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Gng10	guanine nucleotide binding protein (G protein), gamma 10		guanine nucleotide binding protein 10	Name updated	1299863	APPROVED
2002-08-07	Gng10	guanine nucleotide binding protein 10			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)