Pdxk (pyridoxal kinase) - Rat Genome Database

Name: Pdxk
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Pdxk (pyridoxal kinase) Rattus norvegicus

Analyze

Symbol:

Pdxk

Name:

pyridoxal kinase

RGD ID:

621324

Description:

Enables pyridoxal binding activity and pyridoxal kinase activity. Involved in several processes, including pyridoxal phosphate biosynthetic process; response to X-ray; and response to progesterone. Predicted to be active in cytosol. Orthologous to human PDXK (pyridoxal kinase); PARTICIPATES IN hypophosphatasia pathway; vitamin B6 metabolic pathway; INTERACTS WITH (+)-pilocarpine; (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC100909742; pyridoxal (pyridoxine, vitamin B6) kinase; pyridoxal kinase-like; pyridoxine kinase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PDXK (pyridoxal kinase)	HGNC	EggNOG, Ensembl, HomoloGene, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pdxk (pyridoxal (pyridoxine, vitamin B6) kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pdxk (pyridoxal kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PDXK (pyridoxal kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pdxk (pyridoxal kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PDXK (pyridoxal kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pdxk (pyridoxal kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PDXK (pyridoxal kinase)	HGNC	Ensembl, HomoloGene, NCBI, OrthoDB, Panther, Treefam
Alliance orthologs ³
Homo sapiens (human):	PDXK (pyridoxal kinase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pdxk (pyridoxal (pyridoxine, vitamin B6) kinase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pdxka (pyridoxal (pyridoxine, vitamin B6) kinase a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pdxkb (pyridoxal (pyridoxine, vitamin B6) kinase b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	BUD16	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pdxk	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pdxk-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	BUD17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pdxk	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	10,209,975 - 10,232,012 (+)	NCBI		GRCr8
mRatBN7.2	20	10,210,276 - 10,232,314 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	10,210,289 - 10,232,110 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	10,909,956 - 10,931,608 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	10,270,865 - 10,292,517 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	10,742,295 - 10,763,997 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	10,930,651 - 10,952,194 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	10,930,518 - 10,952,391 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	13,102,429 - 13,123,972 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	10,541,656 - 10,563,199 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	10,541,882 - 10,563,426 (+)	NCBI
Celera	20	11,721,159 - 11,742,702 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-butoxyethanol (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (EXP)

amitrole (EXP)

ammonium chloride (EXP)

ampicillin (EXP)

bisphenol A (EXP,ISO)

bleomycin A2 (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

cadmium sulfate (ISO)

carbaryl (ISO)

carbon nanotube (ISO)

choline (ISO)

chrysene (ISO)

clofibrate (ISO)

dibutyl phthalate (ISO)

dimethoate (EXP,ISO)

diquat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

genistein (EXP)

gentamycin (EXP)

GW 4064 (ISO)

inulin (ISO)

L-methionine (ISO)

methamphetamine (EXP)

methapyrilene (EXP)

methimazole (EXP)

metronidazole (EXP)

Muraglitazar (EXP)

N-methyl-4-phenylpyridinium (ISO)

neomycin (EXP)

paracetamol (EXP,ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

pyridoxal 5'-phosphate (EXP)

sodium arsenite (EXP,ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

Tesaglitazar (EXP)

tetrachloromethane (EXP)

trimellitic anhydride (ISO)

valproic acid (ISO)

vancomycin (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of apoptotic process (IMP)

pyridoxal 5'-phosphate salvage (IBA,IEA)

pyridoxal metabolic process (ISO)

pyridoxal phosphate biosynthetic process (IDA)

pyridoxal phosphate metabolic process (ISO)

pyridoxamine metabolic process (ISO)

response to amine (IEP)

response to food (IEP)

response to insecticide (IEP)

response to progesterone (IEP)

response to toxic substance (IEP)

response to X-ray (IEP)

response to xenobiotic stimulus (IEP)

Cellular Component

cytosol (IBA,IEA,ISO)

Molecular Function

ATP binding (IEA)

metal ion binding (IEA)

organic cyclic compound binding (IPI)

phosphotransferase activity, alcohol group as acceptor (ISO)

pyridoxal binding (IDA)

pyridoxal kinase activity (IBA,IDA,IEA,ISO)

small molecule binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

hypophosphatasia pathway (ISO)

vitamin B6 metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Roscovitine targets, protein kinases and pyridoxal kinase.	Bach S, etal., J Biol Chem. 2005 Sep 2;280(35):31208-19. Epub 2005 Jun 23.
2.	Rapid purification by affinity chromatography of rat brain pyridoxal kinase and pyridoxamine-5-phosphate oxidase.	Cash CD, etal., Biochem Biophys Res Commun. 1980 Oct 31;96(4):1755-60.
3.	Glutamate decarboxylase inhibition and vitamin B6 metabolism in brain of cirrhotic rats chronically treated with carbon tetrachloride.	Diaz-Munoz M and Tapia R, J Neurosci Res. 1988 Jul;20(3):376-82.
4.	Levodopa-mediated alteration in the activity of pyridoxal kinase in rat basal ganglia.	Ebadi M, etal., Pharmacology. 1978;17(3):149-56.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Human pyridoxal kinase. cDNA cloning, expression, and modulation by ligands of the benzodiazepine receptor.	Hanna MC, etal., J Biol Chem 1997 Apr 18;272(16):10756-60.
7.	Effects of some insecticides on several enzymes of tryptophan metabolism in rats.	Hassan AA, etal., J Environ Sci Health B. 1990 Jun;25(3):333-46.
8.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
9.	Azo dye-induced alterations in vitamin B-6 metabolism and in pyridoxal 5'-phosphate-binding proteins in rat liver.	Kittler JM, etal., J Nutr. 1986 Apr;116(4):588-98.
10.	A novel role of circadian transcription factor DBP in hippocampal plasticity.	Klugmann M, etal., Mol Cell Neurosci. 2006 Feb;31(2):303-14. Epub 2005 Oct 27.
11.	Vitamin B6 metabolism in McA-RH7777 cells.	Meisler NT and Thanassi JW, Cancer Res. 1988 Mar 1;48(5):1080-5.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	[The content of pyridoxal coenzymes in the brain and liver of rats exposed to a single irradiation with x-rays]	Pikulev AT, etal., Radiobiologiia. 1989 Jan-Feb;29(1):70-3.
15.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
16.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
17.	GOA pipeline	RGD automated data pipeline
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Repression of anti-apoptotic genes via AP-1 as a mechanism of apoptosis induction in ventricular cardiomyocytes.	Schlieper A, etal., Pflugers Arch. 2007 Apr;454(1):53-61. Epub 2006 Nov 18.
20.	Effect of tryptophan metabolites on the activities of rat liver pyridoxal kinase and pyridoxamine 5-phosphate oxidase in vitro.	Takeuchi F, etal., Biochem J. 1985 Apr 15;227(2):537-44.
21.	Vitamin B-6 metabolism in the pregnant rat: effect of progesterone on the (re)distribution in maternal vitamin B-6 stores.	Van den Berg H and Bogaards JJ, J Nutr. 1987 Nov;117(11):1866-74.
22.	The influence of dietary restriction on vitamin B-6 vitamer distribution and on vitamin B-6 metabolizing enzymes in rats.	Wei IL J Am Coll Nutr. 1999 Apr;18(2):144-51.

Additional References at PubMed

PMID:9252787	PMID:10930737	PMID:10987144	PMID:16600635	PMID:16780588	PMID:17766369	PMID:19056867	PMID:21630459	PMID:23376485	PMID:31187503

Genomics

Comparative Map Data

Pdxk
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	10,209,975 - 10,232,012 (+)	NCBI		GRCr8
mRatBN7.2	20	10,210,276 - 10,232,314 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	10,210,289 - 10,232,110 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	10,909,956 - 10,931,608 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	10,270,865 - 10,292,517 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	10,742,295 - 10,763,997 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	10,930,651 - 10,952,194 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	10,930,518 - 10,952,391 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	13,102,429 - 13,123,972 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	10,541,656 - 10,563,199 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	10,541,882 - 10,563,426 (+)	NCBI
Celera	20	11,721,159 - 11,742,702 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

PDXK
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	43,737,000 - 43,738,097 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	21	43,719,094 - 43,762,307 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	21	45,138,978 - 45,182,188 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	43,963,406 - 44,006,616 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	21	43,963,405 - 44,006,608	NCBI
Celera	21	30,244,819 - 30,287,780 (+)	NCBI		Celera
Cytogenetic Map	21	q22.3	NCBI
HuRef	21	30,506,765 - 30,550,585 (+)	NCBI		HuRef
CHM1_1	21	44,717,696 - 44,718,791 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	21	42,092,543 - 42,093,640 (+)	NCBI		T2T-CHM13v2.0

Pdxk
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	78,272,581 - 78,300,782 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	78,272,578 - 78,300,809 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	78,436,747 - 78,464,948 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	78,436,744 - 78,464,975 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	77,899,492 - 77,927,693 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	77,842,099 - 77,868,104 (-)	NCBI		MGSCv36	mm8
Celera	10	79,458,844 - 79,487,046 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Pdxk
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	41,482,216 - 41,494,177 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955407	41,482,216 - 41,494,174 (-)	NCBI	ChiLan1.0	ChiLan1.0

PDXK
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	22	39,727,200 - 39,771,206 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	21	34,577,814 - 34,621,766 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	21	29,977,286 - 30,021,266 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	21	43,276,660 - 43,319,866 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	21	43,273,237 - 43,313,637 (+)	Ensembl	panpan1.1		panPan2

Pdxk
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404971	36,928,712 - 36,956,834 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936500	509,510 - 529,455 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936500	510,977 - 539,166 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDXK
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	87,489,249 - 87,534,376 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	87,489,315 - 87,531,621 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	15,561,891 - 15,606,396 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pdxk
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624745	30,157,446 - 30,175,803 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624745	30,157,446 - 30,175,905 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pdxk
243 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	26
Count of miRNA genes:	25
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000001589
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	6691706	17489458	Rat
1581577	Pur15	Proteinuria QTL 15	4.38	0.0002	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	20	8042410	17617956	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
631265	Iresp1	Immunoglobin response QTL1	8.3		blood anti-double stranded DNA antibody amount (VT:0004762)	serum anti-DNA antibody level (CMO:0001533)	20	9039719	13461775	Rat

Markers in Region

RH126288

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	10,168,469 - 10,168,922 (+)	MAPPER	mRatBN7.2
mRatBN7.2	20	10,231,575 - 10,232,021 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	10,951,833 - 10,952,278	NCBI	Rnor6.0
Rnor_6.0	20	10,889,488 - 10,889,941	NCBI	Rnor6.0
Rnor_5.0	20	13,123,611 - 13,124,056	UniSTS	Rnor5.0
Rnor_5.0	20	13,061,266 - 13,061,719	UniSTS	Rnor5.0
RGSC_v3.4	20	10,562,838 - 10,563,283	UniSTS	RGSC3.4
RGSC_v3.4	20	10,499,734 - 10,500,186	UniSTS	RGSC3.4
Celera	20	11,679,528 - 11,679,980	UniSTS
Celera	20	11,742,341 - 11,742,786	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	6	34	26	11	26			68	35	24	6
Low	1	37	23	15	8	15	8	11	6		17	5	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF020346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001589 ⟹ ENSRNOP00000001589

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	10,210,289 - 10,232,110 (+)	Ensembl
Rnor_6.0 Ensembl	20	10,930,518 - 10,952,391 (+)	Ensembl

RefSeq Acc Id:

NM_031769 ⟹ NP_113957

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	10,209,975 - 10,232,012 (+)	NCBI
mRatBN7.2	20	10,210,276 - 10,232,314 (+)	NCBI
Rnor_6.0	20	10,930,651 - 10,952,194 (+)	NCBI
Rnor_5.0	20	13,102,429 - 13,123,972 (+)	NCBI
RGSC_v3.4	20	10,541,656 - 10,563,199 (+)	RGD
Celera	20	11,721,159 - 11,742,702 (+)	RGD

Sequence:

show sequence

ATGGAGGGCGAATGCCGGGTGCTCTCCATCCAGAGCCATGTTGTCCGCGGCTACGTGGGCAACA
GAGCGGCCATGTTCCCTCTGCAGGTTTTGGGATTTGAGGTTGATGCCGTGAACTCTGTGCAGTT
TTCAAACCACACAGGCTATGCCCACTGGAAGGGGCAGGTGCTGACGTCCCAGGAGCTGCATGCG
CTGTACGAAGGTCTCAAGGCAAACAATGTCAACAAGTATGACTACGTGCTCACTGGTTACACGA
GAGACAAGTCCTTCCTGGGCATGGTGGTGGATATCGTGCAGGAGCTGAAGCAACAGAACTCTCG
ACTCGTGTACGTGTGCGACCCTGTGATGGGCGACAAGTGGAACGGAGAAGGCTCCATGTACGTT
CCCCAGGACCTGCTTCCCGTGTACAGGGAGAAAGTGGTACCCATGGCCGACATCATCACTCCCA
ACCAGTTTGAGGCTGAGTTGCTGAGTGGCAGAAAAATCCACAGCCAAGAAGAAGCATTTGCGGT
GATGGATGTGTTGCACCGCATGGGTCCTGACACTGTGGTCATCACCAGCTCTGACCTCCCCTCC
CCCAAAGGCAGCGACTACCTGATGGCGCTGGGAAGCCAGAGGATGAGGAAGCCTGATGGCTCCA
CAGTGACCCAGCGCATCCGGATGGAGATGCGCAAGGTGGATCCCGTCTTCGTGGGCACCGGGGA
CCTCTTCGCTGCCATGCTTCTGGCGTGGACACACAAACACCCCGACAACCTCAAGGTGGCCTGT
GAGAAAACGGTGTCTGCCATGCAGCATGTCCTGCAGAGGACCATCCGGTGTGCAAAAGCCGAAG
CAGGAGAAGGACAGAAGCCCAGCCCGGCTCAGCTGGAGCTGAGAATGGTGCAGAGCAGGAAGGA
CATCGAGGACCCCGAGATCGTCGTGCAGGCCACGGTGCTGTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113957	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB71400	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001589
	ENSRNOP00000001589.3
GenBank Protein	O35331	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113957 ⟸ NM_031769

- UniProtKB:

G3V647 (UniProtKB/TrEMBL), A6JK21 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGECRVLSIQSHVVRGYVGNRAAMFPLQVLGFEVDAVNSVQFSNHTGYAHWKGQVLTSQELHA
LYEGLKANNVNKYDYVLTGYTRDKSFLGMVVDIVQELKQQNSRLVYVCDPVMGDKWNGEGSMYV
PQDLLPVYREKVVPMADIITPNQFEAELLSGRKIHSQEEAFAVMDVLHRMGPDTVVITSSDLPS
PKGSDYLMALGSQRMRKPDGSTVTQRIRMEMRKVDPVFVGTGDLFAAMLLAWTHKHPDNLKVAC
EKTVSAMQHVLQRTIRCAKAEAGEGQKPSPAQLELRMVQSRKDIEDPEIVVQATVL

hide sequence

RefSeq Acc Id:

ENSRNOP00000001589 ⟸ ENSRNOT00000001589

Protein Domains

Pyridoxamine kinase/Phosphomethylpyrimidine kinase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35331-F1-model_v2	AlphaFold	O35331	1-312	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701483

Promoter ID:

EPDNEW_R12007

Type:

multiple initiation site

Name:

Pdxk_1

Description:

pyridoxal kinase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	10,930,590 - 10,930,650	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621324	AgrOrtholog
BioCyc Gene	G2FUF-4286	BioCyc
BioCyc Pathway	PLPSAL-PWY [pyridoxal 5'-phosphate salvage I]	BioCyc
BioCyc Pathway Image	PLPSAL-PWY	BioCyc
Ensembl Genes	ENSRNOG00000049937	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001589	ENTREZGENE
	ENSRNOT00000001589.7	UniProtKB/TrEMBL
Gene3D-CATH	3.40.1190.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	PM/HMP-P_kinase-1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PyrdxlKinase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribokinase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:83578	UniProtKB/Swiss-Prot
NCBI Gene	83578	ENTREZGENE
PANTHER	PTHR10534	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PYRIDOXAL KINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Phos_pyr_kin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pdxk	PhenoGen
RatGTEx	ENSRNOG00000049937	RatGTEx
Superfamily-SCOP	SSF53613	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6JK21	ENTREZGENE, UniProtKB/TrEMBL
	G3V647	ENTREZGENE, UniProtKB/TrEMBL
	O35331	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Pdxk	pyridoxal kinase	LOC100909742	pyridoxal kinase-like	Data merged from RGD:6502017	737654	PROVISIONAL
2017-02-01	Pdxk	pyridoxal kinase	Pdxk	pyridoxal (pyridoxine, vitamin B6) kinase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100909742	pyridoxal kinase-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-09-10	Pdxk	pyridoxal (pyridoxine, vitamin B6) kinase		pyridoxal kinase	Name updated	1299863	APPROVED
2002-08-07	Pdxk	pyridoxal kinase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways