Tradd (TNFRSF1A-associated via death domain)

Gene: Tradd (TNFRSF1A-associated via death domain) Rattus norvegicus

Analyze

Symbol:

Tradd

Name:

TNFRSF1A-associated via death domain

RGD ID:

621313

Description:

Enables tumor necrosis factor receptor binding activity. Predicted to be involved in several processes, including canonical NF-kappaB signal transduction; cell surface receptor signaling pathway; and positive regulation of canonical NF-kappaB signal transduction. Part of protein-containing complex. Orthologous to human TRADD (TNFRSF1A associated via death domain); PARTICIPATES IN ceramide signaling pathway; Toll-like receptor signaling pathway; Trail mediated signaling pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,046,057 - 50,048,158 (-)	NCBI		GRCr8
mRatBN7.2	19	33,136,148 - 33,142,714 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,136,138 - 33,142,638 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	39,951,075 - 39,953,176 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	40,604,983 - 40,607,084 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	42,894,707 - 42,896,808 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,214,461 - 37,221,099 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,214,471 - 37,216,572 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,081,076 - 48,086,774 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,073,150 - 35,075,251 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	35,078,569 - 35,079,048 (-)	NCBI
Celera	19	32,565,129 - 32,567,230 (-)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant dyskeratosis congenita 6 (ISO)

cataract 5 multiple types (ISO)

genetic disease (ISO)

Liver Reperfusion Injury (IEP)

Optic Nerve Injuries (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1'-acetoxychavicol acetate (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

Aloe emodin (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

beta-naphthoflavone (EXP)

Beta-Solamarine (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

curcumin (ISO)

cylindrospermopsin (ISO)

dexamethasone (ISO)

diazinon (EXP)

dieldrin (EXP)

dioscin (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

ethylparaben (ISO)

folic acid (ISO)

gentamycin (EXP)

hesperidin (ISO)

hydrogen peroxide (ISO)

hydroquinone (ISO)

hydroxyurea (ISO)

indometacin (ISO)

irinotecan (ISO)

iron(2+) sulfate (anhydrous) (ISO)

ivermectin (ISO)

kojic acid (EXP)

leflunomide (ISO)

mangiferin (ISO)

melatonin (ISO)

menadione (ISO)

mercury atom (EXP)

mercury(0) (EXP)

metformin (ISO)

methotrexate (ISO)

monocrotaline (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nickel dichloride (EXP)

nitrates (EXP)

o-anisidine (ISO)

ozone (ISO)

p-menthan-3-ol (ISO)

paclitaxel (ISO)

paracetamol (ISO)

paraquat (ISO)

parthenolide (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

phenytoin (ISO)

progesterone (ISO)

propylparaben (ISO)

pyrethrins (ISO)

quercetin (ISO)

quercetin 3-O-beta-D-glucofuranoside (EXP)

quercetin 3-O-beta-D-glucopyranoside (EXP)

resveratrol (ISO)

Rhein (ISO)

rifampicin (ISO)

SB 431542 (ISO)

simvastatin (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

thioacetamide (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

vorinostat (ISO)

zerumbone (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

canonical NF-kappaB signal transduction (ISO)

cell surface receptor protein tyrosine kinase signaling pathway (IEA)

cellular response to tumor necrosis factor (ISO)

extrinsic apoptotic signaling pathway (IBA,ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

positive regulation of cell migration (ISO)

positive regulation of hair follicle development (ISO)

positive regulation of inflammatory response (ISO)

tumor necrosis factor-mediated signaling pathway (ISO)

Cellular Component

cytoplasm (ISO)

cytoskeleton (IEA)

nucleus (IEA)

plasma membrane (ISO)

protein-containing complex (IDA)

receptor complex (ISO)

tumor necrosis factor receptor superfamily complex (IBA,ISO)

Molecular Function

death domain binding (ISO)

identical protein binding (ISO)

kinase binding (ISO)

molecular adaptor activity (ISO)

protein binding (IPI,ISO)

protein-containing complex binding (IPI)

signaling adaptor activity (ISO)

transmembrane receptor protein tyrosine kinase adaptor activity (IBA,ISO)

tumor necrosis factor receptor binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

apoptotic cell death pathway (IEA)

ceramide signaling pathway (ISO)

hepatitis C pathway (IEA)

Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway (IEA)

Toll-like receptor signaling pathway (ISO)

Trail mediated signaling pathway (ISO)

tuberculosis pathway (IEA)

tumor necrosis factor mediated signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Time course profiling of the retinal transcriptome after optic nerve transection and optic nerve crush.	Agudo M, etal., Mol Vis. 2008 Jun 3;14:1050-63.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Role of heme oxygenase 1 in TNF/TNF receptor-mediated apoptosis after hepatic ischemia/reperfusion in rats.	Kim SJ, etal., Shock. 2013 Apr;39(4):380-8. doi: 10.1097/SHK.0b013e31828aab7f.
4.	Pathogen recognition by the innate immune system.	Kumar H, etal., Int Rev Immunol. 2011 Feb;30(1):16-34.
5.	Tumor necrosis factor receptor 1 and its signaling intermediates are recruited to lipid rafts in the traumatized brain.	Lotocki G, etal., J Neurosci. 2004 Dec 8;24(49):11010-6.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	14-Deoxyandrographolide desensitizes hepatocytes to tumour necrosis factor-alpha-induced apoptosis through calcium-dependent tumour necrosis factor receptor superfamily member 1A release via the NO/cGMP pathway.	Roy DN, etal., Br J Pharmacol. 2010 Aug;160(7):1823-43.
13.	Formation of a tumour necrosis factor receptor 1 molecular scaffolding complex and activation of apoptosis signal-regulating kinase 1 during seizure-induced neuronal death.	Shinoda S, etal., Eur J Neurosci. 2003 May;17(10):2065-76.
14.	Vulnerability of monoaminergic neurons in the brainstem of the zitter rat in oxidative stress.	Ueda S, etal., Prog Brain Res 2002;136:293-302.
15.	Tumor necrosis factor signaling.	Wajant H, etal., Cell Death Differ. 2003 Jan;10(1):45-65.

Additional References at PubMed

PMID:7758105	PMID:8612133	PMID:11684708	PMID:12761501	PMID:14743216	PMID:16611992	PMID:16702408	PMID:19541932	PMID:22089168	PMID:22510408	PMID:23429285	PMID:23574812
PMID:25732226	PMID:30561431

Genomics

Comparative Map Data

Tradd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,046,057 - 50,048,158 (-)	NCBI		GRCr8
mRatBN7.2	19	33,136,148 - 33,142,714 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,136,138 - 33,142,638 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	39,951,075 - 39,953,176 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	40,604,983 - 40,607,084 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	42,894,707 - 42,896,808 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,214,461 - 37,221,099 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,214,471 - 37,216,572 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,081,076 - 48,086,774 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,073,150 - 35,075,251 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	35,078,569 - 35,079,048 (-)	NCBI
Celera	19	32,565,129 - 32,567,230 (-)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

TRADD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	67,154,185 - 67,159,909 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	67,154,185 - 67,159,909 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	67,188,088 - 67,193,812 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	65,745,589 - 65,751,313 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	65,745,604 - 65,747,759	NCBI
Celera	16	51,696,331 - 51,702,055 (-)	NCBI		Celera
Cytogenetic Map	16	q22.1	NCBI
HuRef	16	53,061,605 - 53,067,329 (-)	NCBI		HuRef
CHM1_1	16	68,595,406 - 68,601,130 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	72,948,477 - 72,954,201 (-)	NCBI		T2T-CHM13v2.0

Tradd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	105,985,207 - 105,991,226 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	105,984,918 - 105,991,241 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	105,258,575 - 105,264,594 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	105,258,286 - 105,264,609 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	107,782,475 - 107,788,494 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	108,147,704 - 108,153,723 (-)	NCBI		MGSCv36	mm8
Celera	8	109,481,639 - 109,487,742 (-)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	53.04	NCBI

Tradd
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	9,456,301 - 9,462,425 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955484	9,456,268 - 9,462,425 (+)	NCBI	ChiLan1.0	ChiLan1.0

TRADD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	76,683,947 - 76,689,812 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	82,596,528 - 82,602,315 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	47,499,881 - 47,506,220 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	66,888,543 - 66,892,501 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	66,889,006 - 66,891,016 (-)	Ensembl	panpan1.1		panPan2

TRADD
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	82,200,430 - 82,211,430 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	82,206,111 - 82,210,963 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	82,189,185 - 82,200,059 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	82,634,875 - 82,645,756 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	82,634,842 - 82,645,749 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	82,460,961 - 82,471,833 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	82,146,502 - 82,157,169 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	82,785,778 - 82,796,660 (+)	NCBI		UU_Cfam_GSD_1.0

Tradd
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	41,954,016 - 41,960,812 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	17,628,803 - 17,630,856 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	17,628,297 - 17,634,919 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TRADD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	27,797,607 - 27,804,423 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	27,797,594 - 27,804,654 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

TRADD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	60,296,777 - 60,303,076 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	60,297,375 - 60,303,579 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	23,048,918 - 23,055,198 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tradd
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	19,155,113 - 19,165,705 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	19,155,058 - 19,165,702 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tradd
19 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	67
Count of miRNA genes:	59
Interacting mature miRNAs:	64
Transcripts:	ENSRNOT00000020405
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	24817978	39654489	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	27530207	37947399	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	27530207	37947399	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	27530207	37947399	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat

Markers in Region

RH130583

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	33,136,186 - 33,136,397 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	37,214,510 - 37,214,720	NCBI	Rnor6.0
Rnor_5.0	19	48,081,125 - 48,081,335	UniSTS	Rnor5.0
RGSC_v3.4	19	35,073,189 - 35,073,399	UniSTS	RGSC3.4
Celera	19	32,565,168 - 32,565,378	UniSTS
Cytogenetic Map	19	q11	UniSTS

PMC305633P3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	33,136,593 - 33,137,120 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	37,214,917 - 37,215,443	NCBI	Rnor6.0
Rnor_5.0	19	48,081,532 - 48,082,058	UniSTS	Rnor5.0
RGSC_v3.4	19	35,073,596 - 35,074,122	UniSTS	RGSC3.4
Celera	19	32,565,575 - 32,566,101	UniSTS
Cytogenetic Map	19	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3		15	3	17	3			4	19	23	11
Low		43	42	38	2	38	8	11	70	16	18		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006255442	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097477	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF517017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000020405 ⟹ ENSRNOP00000020405

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	33,136,138 - 33,142,638 (-)	Ensembl
Rnor_6.0 Ensembl	19	37,214,471 - 37,216,572 (-)	Ensembl

RefSeq Acc Id:

NM_001100480 ⟹ NP_001093950

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,046,057 - 50,048,158 (-)	NCBI
mRatBN7.2	19	33,136,148 - 33,138,249 (-)	NCBI
Rnor_6.0	19	37,214,471 - 37,216,572 (-)	NCBI
Rnor_5.0	19	48,081,076 - 48,086,774 (-)	NCBI
RGSC_v3.4	19	35,073,150 - 35,075,251 (-)	RGD
Celera	19	32,565,129 - 32,567,230 (-)	RGD

Sequence:

show sequence

ATGGCAGCTGATCAGAATGGCCATGAGGAGTGGGTGGGCAGTGCATACCTGTTTTTGGAGTCTT
CGATGGACAAAGTGGTCCTATCTGAAGCCTACACAGATCCCAAGAAGAAAGTGGCAATCTACAA
GGCTCTGCAGGCTGCATTGTCAGAGAGTGGGGACAGCCCCGACGTACTGCAGATACTCAAGATC
CACTGCAGCGACCCTCAGCTCATCGTTCAGTTGCGTTTCTGCGGGCGCCTGCTATGCGGCCGCT
TTCTCCAAGCCTACCGCGAGGGGGCGCTGCGCACCGCACTGCAGAGGTGCATGGCCGCGGCGCT
TGCCCAGGAAGCAGTGCGGTTGCAACTGGAGTTGCGTGCTGGTGCGGAGCAGCTGGACAGTTGG
CTGACCGACGAAGAGCGCTGTTTGAATTACATCTTAGCCCAGAAGCCCGACCGGCTCAGGGACG
AAGAACTCGCGGAGCTGGAGGATGAGTTCTGCAAACTGACGTGTGACTCCACTGGCCAGGGTGG
AGCCACACAGGTAGCTCCAGCAGGTTCGAAGTCCCTGGTTTCCTCTCCGGCCGAGGAGAAGCCA
CTGCCGGCCGCCGGCCAGACTTTTCTGTTCCATGGTCAGCTCATAGTGAACCGGCCACTGAATC
TGCAAGACCAGCAGACATTCGCGCGCTCAGTGGGCCTCAAGTGGCGCAGGGTAGGGCGCTCGCT
GCAGCGTAGCTGTCGAGCACTGAGGGATCCTGCCCTCGACTCGCTGGCCTATGAGTATGAGCGT
GATGGGCTATATGAGCAGGCCTTCCAGCTGCTGCGCCGTTTCATACAAGCCGAGGGCCGCCGTG
CCACACTGCAACGCCTAGTGGAGGCGCTGGAGGAGAACGAGCTCACTAGTCTAGCAGAAGATCT
GCTAGGCCAGGCGGAGCCGGAAGGCGGCCAGGCTTAAGTCTAGTACTGTGGGAAAGGGCCACTG
GTCAACCAGTTCAGCCAGTGTTTGGAACCCACTGGGGACTGTTGGGGTCCTTTTACTGCTGATG
TTGCTACTGCTGGCTATTTGCCATCCACTGGACTCGGAGAACGTACACACTCCCCTACCTAGCT
GAGCTGCTGGAGTGAACTAACTGCCCCTCCCCCTCCCCAGGAGCCAGGCAAGCACCGCAGGGGT
ACAGAAAGAGGACTTCCTGCAGAAACTCACTAAGAAACTGGACCTTCTGAAACCTAGATGTCAT
TCAAGGTGCTACAAAAACTGTCACGAGCAGGATGCACGATTTTCCCTGCCCTTGGCTCATTCTC
ATCGTGGGACCTAAGTACTTGGCAGCGATAATAAAATGTAACCCTTTTATAGA

hide sequence

RefSeq Acc Id:

XM_039097477 ⟹ XP_038953405

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,046,059 - 50,048,158 (-)	NCBI
mRatBN7.2	19	33,136,152 - 33,142,714 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001093950	(Get FASTA)	NCBI Sequence Viewer
	XP_038953405	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAM74196	(Get FASTA)	NCBI Sequence Viewer
	EDL92353	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020405.4

RefSeq Acc Id:

NP_001093950 ⟸ NM_001100480

- UniProtKB:

D3ZZC5 (UniProtKB/TrEMBL), A6IYM5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAADQNGHEEWVGSAYLFLESSMDKVVLSEAYTDPKKKVAIYKALQAALSESGDSPDVLQILKI
HCSDPQLIVQLRFCGRLLCGRFLQAYREGALRTALQRCMAAALAQEAVRLQLELRAGAEQLDSW
LTDEERCLNYILAQKPDRLRDEELAELEDEFCKLTCDSTGQGGATQVAPAGSKSLVSSPAEEKP
LPAAGQTFLFHGQLIVNRPLNLQDQQTFARSVGLKWRRVGRSLQRSCRALRDPALDSLAYEYER
DGLYEQAFQLLRRFIQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPEGGQA

hide sequence

RefSeq Acc Id:

ENSRNOP00000020405 ⟸ ENSRNOT00000020405

RefSeq Acc Id:	XP_038953405 ⟸ XM_039097477
- Peptide Label:	isoform X1

Protein Domains

Death

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZZC5-F1-model_v2	AlphaFold	D3ZZC5	1-310	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621313	AgrOrtholog
BioCyc Gene	G2FUF-5852	BioCyc
Ensembl Genes	ENSRNOG00000015179	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000020405.7	UniProtKB/TrEMBL
Gene3D-CATH	1.10.533.10	UniProtKB/TrEMBL
	3.30.70.680	UniProtKB/TrEMBL
InterPro	DEATH-like_dom	UniProtKB/TrEMBL
	Death_domain	UniProtKB/TrEMBL
	TRADD	UniProtKB/TrEMBL
	TRADD_N	UniProtKB/TrEMBL
	TRADD_N_sf	UniProtKB/TrEMBL
KEGG Report	rno:246756	UniProtKB/TrEMBL
NCBI Gene	246756	ENTREZGENE
PANTHER	PTHR14913	UniProtKB/TrEMBL
	TUMOR NECROSIS FACTOR RECEPTOR TYPE 1-ASSOCIATED DEATH DOMAIN PROTEIN	UniProtKB/TrEMBL
Pfam	Death	UniProtKB/TrEMBL
	TRADD_N	UniProtKB/TrEMBL
PhenoGen	Tradd	PhenoGen
PROSITE	DEATH_DOMAIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015179	RatGTEx
SMART	DEATH	UniProtKB/TrEMBL
Superfamily-SCOP	DEATH_like	UniProtKB/TrEMBL
	TRADD_N	UniProtKB/TrEMBL
UniProt	A6IYM5	ENTREZGENE, UniProtKB/TrEMBL
	D3ZZC5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Tradd	TNFRSF1A-associated via death domain			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Tradd	TNFRSF1A-associated via death domain			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)