Anp32b (acidic nuclear phosphoprotein 32 family member B)

Gene: Anp32b (acidic nuclear phosphoprotein 32 family member B) Rattus norvegicus

Analyze

Symbol:

Anp32b

Name:

acidic nuclear phosphoprotein 32 family member B

RGD ID:

621285

Description:

Predicted to enable RNA polymerase binding activity and histone binding activity. Involved in negative regulation of apoptotic process; positive regulation of G1/S transition of mitotic cell cycle; and positive regulation of cell population proliferation. Predicted to be located in cytoplasm and nucleoplasm. Predicted to be active in nucleus. Predicted to colocalize with nucleolus. Orthologous to human ANP32B (acidic nuclear phosphoprotein 32 family member B); PARTICIPATES IN CRM1 export pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

acidic (leucine-rich) nuclear phosphoprotein 32 family, member B; acidic leucine-rich nuclear phosphoprotein 32 family member B; acidic nuclear phosphoprotein 32 family, member B; PAL31; proliferation related acidic leucine rich protein PAL31; proliferation-related acidic leucine-rich protein PAL31

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	65,538,872 - 65,561,305 (+)	NCBI		GRCr8
mRatBN7.2	5	60,743,077 - 60,765,726 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	60,743,443 - 60,765,717 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	62,715,573 - 62,737,025 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	64,534,945 - 64,556,401 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	64,504,360 - 64,525,815 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	62,070,709 - 62,094,633 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	62,071,346 - 62,094,633 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	66,592,162 - 66,624,323 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	63,044,718 - 63,058,038 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	63,044,896 - 63,058,218 (+)	NCBI
Celera	5	59,304,609 - 59,327,346 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital disorder of glycosylation Ii (ISO)

congenital disorder of glycosylation type II (ISO)

congenital myasthenic syndrome 14 (ISO)

Generalized Epilepsy (ISO)

genetic disease (ISO)

intellectual disability (ISO)

nephronophthisis (ISO)

Spinal Cord Injuries (IEP)

thoracic aortic aneurysm (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

aminoglutethimide (ISO)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

busulfan (ISO)

butanal (ISO)

cadmium dichloride (EXP)

cannabidiol (ISO)

carbon nanotube (ISO)

carbonyl sulfide (EXP)

CGP 52608 (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

choline (ISO)

chromium(6+) (ISO)

clofarabine (ISO)

clofibric acid (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

diethylstilbestrol (ISO)

diuron (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

ivermectin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

menadione (ISO)

methimazole (EXP)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

propanal (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

Soman (EXP)

T-2 toxin (EXP)

thimerosal (ISO)

thioacetamide (EXP)

topotecan (EXP)

trichloroethene (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

troglitazone (ISO)

valproic acid (ISO)

vitamin E (ISO)

vorinostat (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

inner ear development (IEA,ISO)

negative regulation of apoptotic process (IMP)

negative regulation of cell differentiation (IEA,ISO)

nucleosome assembly (IEA,ISO)

positive regulation of cell population proliferation (IMP)

positive regulation of G1/S transition of mitotic cell cycle (IMP)

positive regulation of protein export from nucleus (IEA,ISO)

regulation of apoptotic process (IBA,IEA)

roof of mouth development (IEA,ISO)

vasculature development (IEA,ISO)

ventricular system development (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

nucleolus (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

histone binding (IBA,IEA,ISO)

protein binding (IPI,ISO)

RNA polymerase binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

CRM1 export pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Synaptotagmin 11 interacts with components of the RNA-induced silencing complex RISC in clonal pancreatic beta-cells.	Milochau A, etal., FEBS Lett. 2014 Jun 27;588(14):2217-22. doi: 10.1016/j.febslet.2014.05.031. Epub 2014 May 29.
4.	Postage for the messenger: designating routes for nuclear mRNA export.	Natalizio BJ and Wente SR, Trends Cell Biol. 2013 Aug;23(8):365-73. doi: 10.1016/j.tcb.2013.03.006. Epub 2013 Apr 11.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	PAL31, a nuclear protein required for progression to the S phase.	Sun W, etal., Biochem Biophys Res Commun 2001 Feb 2;280(4):1048-54.
10.	Proliferation related acidic leucine-rich protein PAL31 functions as a caspase-3 inhibitor.	Sun W, etal., Biochem Biophys Res Commun. 2006 Apr 14;342(3):817-23. Epub 2006 Feb 17.
11.	Cytoprotective and anti-inflammatory effects of PAL31 overexpression in glial cells.	Tseng FW, etal., J Biomed Sci. 2014 Jul 17;21:60. doi: 10.1186/1423-0127-21-60.

Additional References at PubMed

PMID:9285060	PMID:10716735	PMID:10913355	PMID:12477932	PMID:14703996	PMID:15489334	PMID:15895553	PMID:16791210	PMID:17178712	PMID:19141070	PMID:20015864	PMID:20458337
PMID:20538007	PMID:21636789	PMID:22705300	PMID:25931508	PMID:31505169

Genomics

Comparative Map Data

Anp32b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	65,538,872 - 65,561,305 (+)	NCBI		GRCr8
mRatBN7.2	5	60,743,077 - 60,765,726 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	60,743,443 - 60,765,717 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	62,715,573 - 62,737,025 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	64,534,945 - 64,556,401 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	64,504,360 - 64,525,815 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	62,070,709 - 62,094,633 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	62,071,346 - 62,094,633 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	66,592,162 - 66,624,323 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	63,044,718 - 63,058,038 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	63,044,896 - 63,058,218 (+)	NCBI
Celera	5	59,304,609 - 59,327,346 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

ANP32B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	97,983,341 - 98,015,943 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	97,983,341 - 98,015,943 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	100,745,623 - 100,778,225 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	99,785,310 - 99,818,046 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	97,825,197 - 97,857,776	NCBI
Celera	9	71,259,753 - 71,292,490 (+)	NCBI		Celera
Cytogenetic Map	9	q22.33	NCBI
HuRef	9	70,346,857 - 70,378,291 (+)	NCBI		HuRef
CHM1_1	9	100,892,012 - 100,924,659 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	110,155,281 - 110,187,884 (+)	NCBI		T2T-CHM13v2.0

Anp32b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	46,450,926 - 46,472,657 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	46,450,902 - 46,472,657 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	46,450,926 - 46,472,657 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	46,450,902 - 46,472,657 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	46,463,989 - 46,485,395 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	46,472,215 - 46,493,623 (+)	NCBI		MGSCv36	mm8
Celera	4	46,475,780 - 46,497,386 (+)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	24.79	NCBI

Anp32b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	27,471,930 - 27,488,065 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	27,471,539 - 27,553,078 (-)	NCBI	ChiLan1.0	ChiLan1.0

ANP32B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	41,439,478 - 41,477,862 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	41,441,855 - 41,479,153 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	69,075,972 - 69,108,178 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	97,198,447 - 97,228,536 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	97,207,823 - 97,228,542 (+)	Ensembl	panpan1.1		panPan2

ANP32B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	55,230,017 - 55,272,744 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	55,243,854 - 55,350,194 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	53,663,727 - 53,706,272 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	56,342,087 - 56,384,716 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	56,360,282 - 56,462,127 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	54,838,237 - 54,880,571 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	54,868,718 - 54,911,284 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	55,565,302 - 55,607,676 (+)	NCBI		UU_Cfam_GSD_1.0

Anp32b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	170,187,829 - 170,210,294 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	6,742,853 - 6,756,038 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	6,735,047 - 6,757,874 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ANP32B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	239,842,067 - 239,868,403 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	239,842,062 - 239,868,404 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	268,022,424 - 268,037,942 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ANP32B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	41,400,796 - 41,432,756 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	41,401,188 - 41,432,711 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	38,442,243 - 38,474,164 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Anp32b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624825	2,814,758 - 2,844,008 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Anp32b
144 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	38
Count of miRNA genes:	37
Interacting mature miRNAs:	37
Transcripts:	ENSRNOT00000012478
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat

Markers in Region

D5Got293

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	60,773,072 - 60,773,313 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	62,101,984 - 62,102,224	NCBI	Rnor6.0
Rnor_5.0	5	66,629,973 - 66,630,213	UniSTS	Rnor5.0
Rnor_5.0	5	66,610,218 - 66,610,458	UniSTS	Rnor5.0
RGSC_v3.4	5	63,065,305 - 63,065,545	UniSTS	RGSC3.4
Celera	5	59,334,912 - 59,335,152	UniSTS
Cytogenetic Map	5	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	35	48	33	19	33	1	4	68	30	40	11	1
Low		8	9	8		8	7	7	6	5	1		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_131911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008763695	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB025581	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC097073	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000012478 ⟹ ENSRNOP00000012478

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	60,743,443 - 60,765,717 (+)	Ensembl
Rnor_6.0 Ensembl	5	62,071,346 - 62,094,633 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110089 ⟹ ENSRNOP00000088536

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	60,750,610 - 60,765,717 (+)	Ensembl

RefSeq Acc Id:

NM_131911 ⟹ NP_571986

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	65,538,872 - 65,561,305 (+)	NCBI
mRatBN7.2	5	60,743,284 - 60,765,722 (+)	NCBI
Rnor_6.0	5	62,071,346 - 62,094,633 (+)	NCBI
Rnor_5.0	5	66,592,162 - 66,624,323 (+)	NCBI
RGSC_v3.4	5	63,044,718 - 63,058,038 (+)	RGD
Celera	5	59,304,609 - 59,327,346 (+)	RGD

Sequence:

show sequence

GAGTAACTTGGCTCCGGGGGCTCCGCTCGCCCGCACGCCCGCACGCCGCCCGGGACCACGCCGC
CTCCTCCAGCCGCCTCCTTCCGACGGCCCTCGCCGCGCAGGCCGGGTCGCCTCTCCCCCCTCCG
CCCCCGCCGCGGAAAGTTAAGTTTGGAGAGGGGGGACGAGGGGAACATGGACATGAAGAGGAGG
ATCCACCTGGAGCTGAGGAACCGGACCCCGGCAGCTGTTCAAGAACTTGTCTTGGACAATTGCA
AAGCAAATGATGGAAAAATCGAGGGGTTAACAGATGAATTTGTGAACTTAGAGTTCCTCAGTTT
AATAAATGTAGGCTTGTTTTCAGTTTCAGACCTCCCGAAGCTACCTAAGTTGAAAAAGCTTGAG
CTCAGTGAAAATAGAATCTTCGGAGGTCTCGACAGACTAGCAGAAGAACTTCCAAGCCTCACAC
ATCTGAACCTAAGTGGAAATAACCTGAAAGATATCAGCACCTTGGAGCCGTTGAAAAGGTTGGA
TTGTCTGAAAAGCCTGGATCTGTTTGGCTGTGAAGTCACTAACCGGAGTGATTACCGAGAGACC
GTCTTCAGGCTGCTGCCCCAGCTGTCCTATCTGGATGGCTATGACCGAGAGGACCAGGAAGCAC
CTGACTCAGATGTGGAGGTGGATAGTGTAGAGGAAGCCCCCGACTCAGACGGGGAAGTGGATGG
TGTGGACAAAGAGGAAGAGGATGAAGAAGGAGAGGATGAAGAGGAAGAGGAGGATGAGGATGGT
GAGGAGGAAGAAGATGAAGATGAAGAGGATGAAGATGAAGACGAGGATGTAGAAGGAGAAGATG
ATGAAGATGAAGTCAGCGGGGAGGAAGAAGAGTTTGGACATGATGGAGAAGTTGATGAAGATGA
AGAAGATGAGGATGAAGATGAGGATGAAGAGGAGGAAGAAAGTGGGAAAGGTGAAAAGAGAAAG
AGAGAAACAGATGACGAAGGAGAAGATGACTAAGCCCCGGGACAGCCTGCAGGACACAGAACTG
TTGAGTATGGTTGGACTGCTCATGGATTTGGTAGCTGTTTTAAAAAGGTAGCTGTGATACAAGC
CCCAGGACACCCCCACCCAAAGAGCCAAAGAATAGTTCCCGCGACATTCCGCCTTCCTCCGTTT
AGCCCCTTGGTAATCCACCACCAAGCCTGGGGACTTCGCCCCAACAAAATTGTAAGCGTTGTTA
GGTTTTCGTGTAAGACTCTTGCTGTATCGTGACAGCTGTGATTGGTGAGTTGACCGTCCTGGCT
GCCAGTTACACTGCGATTGTAACAACATTTTTACTTTCTGTACAACAAGGAAAAGCTTTGTAAA
TAAAATCTTAACATTTTGGGTCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_571986	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86508	(Get FASTA)	NCBI Sequence Viewer
	BAB12435	(Get FASTA)	NCBI Sequence Viewer
	EDL98840	(Get FASTA)	NCBI Sequence Viewer
	EDL98841	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012478
	ENSRNOP00000012478.5
	ENSRNOP00000088536.1
	ENSRNOP00055029378
	ENSRNOP00060006061
	ENSRNOP00065012969
GenBank Protein	Q9EST6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_571986 ⟸ NM_131911

- UniProtKB:

Q9EST6 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDMKRRIHLELRNRTPAAVQELVLDNCKANDGKIEGLTDEFVNLEFLSLINVGLFSVSDLPKLP
KLKKLELSENRIFGGLDRLAEELPSLTHLNLSGNNLKDISTLEPLKRLDCLKSLDLFGCEVTNR
SDYRETVFRLLPQLSYLDGYDREDQEAPDSDVEVDSVEEAPDSDGEVDGVDKEEEDEEGEDEEE
EEDEDGEEEEDEDEEDEDEDEDVEGEDDEDEVSGEEEEFGHDGEVDEDEEDEDEDEDEEEEESG
KGEKRKRETDDEGEDD

hide sequence

RefSeq Acc Id:

ENSRNOP00000012478 ⟸ ENSRNOT00000012478

RefSeq Acc Id:

ENSRNOP00000088536 ⟸ ENSRNOT00000110089

Protein Domains

LRRCT U2A'/phosphoprotein 32 family A C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EST6-F1-model_v2	AlphaFold	Q9EST6	1-272	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693713

Promoter ID:

EPDNEW_R4237

Type:

initiation region

Name:

Anp32b_1

Description:

acidic nuclear phosphoprotein 32 family member B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	62,071,314 - 62,071,374	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621285	AgrOrtholog
BioCyc Gene	G2FUF-41405	BioCyc
Ensembl Genes	ENSRNOG00000009266	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055021171	UniProtKB/Swiss-Prot
	ENSRNOG00060004865	UniProtKB/Swiss-Prot
	ENSRNOG00065010456	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012478	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000012478.6	UniProtKB/Swiss-Prot
	ENSRNOT00000110089.1	UniProtKB/TrEMBL
	ENSRNOT00055036165	UniProtKB/Swiss-Prot
	ENSRNOT00060008091	UniProtKB/Swiss-Prot
	ENSRNOT00065016934	UniProtKB/Swiss-Prot
Gene3D-CATH	3.80.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7103152	IMAGE-MGC_LOAD
InterPro	AN32	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Leu-rich_rpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LRR_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	U2A'_phosphoprotein32A_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:170724	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91514	IMAGE-MGC_LOAD
NCBI Gene	170724	ENTREZGENE
PANTHER	ACIDIC LEUCINE-RICH NUCLEAR PHOSPHOPROTEIN 32 FAMILY MEMBER B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11375	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	LRR_9	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Anp32b	PhenoGen
PROSITE	LRR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009266	RatGTEx
	ENSRNOG00055021171	RatGTEx
	ENSRNOG00060004865	RatGTEx
	ENSRNOG00065010456	RatGTEx
SMART	LRRcap	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	L domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AAZ7_RAT	UniProtKB/TrEMBL
	A6IJC0_RAT	UniProtKB/TrEMBL
	A6IJC1_RAT	UniProtKB/TrEMBL
	AN32B_RAT	UniProtKB/Swiss-Prot
	F1LP34_RAT	UniProtKB/TrEMBL
	Q9EST6	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-12	Anp32b	acidic nuclear phosphoprotein 32 family member B	Anp32b	acidic (leucine-rich) nuclear phosphoprotein 32 family, member B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Anp32b	acidic (leucine-rich) nuclear phosphoprotein 32 family, member B	Anp32b	acidic nuclear phosphoprotein 32 family, member B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Anp32b	acidic nuclear phosphoprotein 32 family, member B	PAL31	proliferation related acidic leucine rich protein PAL31	Symbol and Name updated	1299863	APPROVED
2002-08-07	PAL31	proliferation related acidic leucine rich protein PAL31			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localizes in the nuclei at the S phase	633716
gene_expression	expressed predominantly in fetal brain; expressed specific to the late G1 and S phases	633716
gene_regulation	induced by prolactin (PRL)	633716

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations