Efna2 (ephrin A2) - Rat Genome Database

Name: Efna2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Efna2 (ephrin A2) Rattus norvegicus

Analyze

Symbol:

Efna2

Name:

ephrin A2

RGD ID:

620389

Description:

Predicted to enable ephrin receptor binding activity. Involved in axon guidance and olfactory bulb development. Located in neuromuscular junction and perikaryon. Orthologous to human EFNA2 (ephrin A2); PARTICIPATES IN altered ephrin - ephrin receptor bidirectional signaling pathway; ephrin - ephrin receptor bidirectional signaling axis; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ephrin A-2; ephrin A-2 precursor; ephrin-A2; LOC314624

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EFNA2 (ephrin A2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Efna2 (ephrin A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Efna2 (ephrin A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EFNA2 (ephrin A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EFNA2 (ephrin A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Efna2 (ephrin A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EFNA2 (ephrin A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EFNA2 (ephrin A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Efna2 (ephrin A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MUS81 (MUS81 structure-specific endonuclease subunit)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	EFNA2 (ephrin A2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Efna2 (ephrin A2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	efna2a (ephrin-A2a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	efn-4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ephrin	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	efna2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	10,167,091 - 10,177,719 (-)	NCBI		GRCr8
mRatBN7.2	7	9,515,635 - 9,528,071 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	9,516,429 - 9,527,061 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	12,399,367 - 12,410,023 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	14,274,704 - 14,285,362 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	12,135,824 - 12,146,446 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	12,382,636 - 12,393,266 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	12,382,636 - 12,393,266 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	12,552,532 - 12,563,371 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	11,028,432 - 11,039,064 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	11,030,443 - 11,030,724 (-)	NCBI
Celera	7	7,692,874 - 7,702,935 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cerebral creatine deficiency syndrome (ISO)

cyclic hematopoiesis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-nicotine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-palmitoylglycerol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

choline (ISO)

cisplatin (ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

diazinon (ISO)

dibutyl phthalate (ISO)

dichloroacetic acid (ISO)

dicrotophos (ISO)

dieldrin (ISO)

fluoranthene (ISO)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

gentamycin (EXP)

glyphosate (EXP)

hydrazine (ISO)

ketamine (EXP)

L-methionine (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

melphalan (ISO)

mercury dibromide (ISO)

methapyrilene (ISO)

nicotine (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon guidance (IBA,IEP)

bone remodeling (IBA,ISO)

ephrin receptor signaling pathway (IBA,ISO,TAS)

inner ear morphogenesis (TAS)

olfactory bulb development (IEP)

osteoclast differentiation (IBA,ISO)

Cellular Component

neuromuscular junction (IDA)

perikaryon (IDA)

plasma membrane (IBA)

side of membrane (IEA)

Molecular Function

ephrin receptor binding (IBA,ISO,TAS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

altered ephrin - ephrin receptor bidirectional signaling pathway (ISS)

ephrin - ephrin receptor bidirectional signaling axis (ISO,TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Expression of Eph receptors in skeletal muscle and their localization at the neuromuscular junction.	Lai KO, etal., Mol Cell Neurosci. 2001 Jun;17(6):1034-47.
3.	Distinct expression patterns of eph receptors and ephrins relate to the structural organization of the adult rat peripheral vestibular system.	Matsunaga T, etal., Eur J Neurosci 2000 May;12(5):1599-616.
4.	Expression and function of the Eph A receptors and their ligands ephrins A in the rat thymus.	Munoz JJ, etal., J Immunol 2002 Jul 1;169(1):177-84.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	EphA receptors and ephrin-A ligands exhibit highly regulated spatial and temporal expression patterns in the developing olfactory system.	St John JA, etal., Brain Res Dev Brain Res 2002 Sep 20;138(1):1-14.
10.	The role of ephrins and Eph receptors in cancer.	Surawska H, etal., Cytokine Growth Factor Rev 2004 Dec;15(6):419-33.
11.	EphA5 and ephrin-A2 expression during optic nerve regeneration: a 'two-edged sword'.	Symonds AC, etal., Eur J Neurosci. 2007 Feb;25(3):744-52.

Additional References at PubMed

PMID:9053851	PMID:14667581	PMID:19299512	PMID:22147308

Genomics

Comparative Map Data

Efna2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	10,167,091 - 10,177,719 (-)	NCBI		GRCr8
mRatBN7.2	7	9,515,635 - 9,528,071 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	9,516,429 - 9,527,061 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	12,399,367 - 12,410,023 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	14,274,704 - 14,285,362 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	12,135,824 - 12,146,446 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	12,382,636 - 12,393,266 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	12,382,636 - 12,393,266 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	12,552,532 - 12,563,371 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	11,028,432 - 11,039,064 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	11,030,443 - 11,030,724 (-)	NCBI
Celera	7	7,692,874 - 7,702,935 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

EFNA2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	1,284,227 - 1,301,431 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	1,285,873 - 1,301,431 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	1,285,872 - 1,301,430 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	1,237,168 - 1,250,944 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	1,237,167 - 1,250,944	NCBI
Celera	19	1,220,457 - 1,234,238 (+)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	1,070,235 - 1,076,114 (+)	NCBI		HuRef
CHM1_1	19	1,286,249 - 1,301,508 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	1,253,481 - 1,270,685 (+)	NCBI		T2T-CHM13v2.0

Efna2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	80,015,316 - 80,025,844 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	80,015,316 - 80,025,844 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	80,179,482 - 80,190,010 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	80,179,482 - 80,190,010 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	79,642,227 - 79,652,755 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	79,582,611 - 79,592,774 (+)	NCBI		MGSCv36	mm8
Celera	10	81,194,340 - 81,204,868 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Efna2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	6,614,791 - 6,627,287 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	6,614,828 - 6,627,287 (-)	NCBI	ChiLan1.0	ChiLan1.0

EFNA2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	5,629,433 - 5,644,680 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	4,866,226 - 4,882,529 (+)	NCBI		NHGRI_mPanPan1

EFNA2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	20	57,304,872 - 57,317,195 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	58,243,472 - 58,257,099 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	58,243,472 - 58,257,443 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	57,299,140 - 57,312,931 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	57,780,042 - 57,792,210 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	57,980,959 - 57,995,187 (-)	NCBI		UU_Cfam_GSD_1.0

Efna2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	217,177,009 - 217,186,441 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	648,336 - 657,785 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	648,336 - 657,768 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EFNA2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	77,165,193 - 77,179,246 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	77,165,187 - 77,179,936 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	77,849,811 - 77,863,280 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EFNA2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	1,054,382 - 1,069,544 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	1,054,483 - 1,068,232 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666081	7,793,189 - 7,808,389 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Efna2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	7,380,554 - 7,393,376 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	7,380,675 - 7,393,322 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Efna2
67 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	174
Count of miRNA genes:	127
Interacting mature miRNAs:	139
Transcripts:	ENSRNOT00000021709
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	80	79	48	25	48	6	207	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001168670	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141331	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF131912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021709 ⟹ ENSRNOP00000021709

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	9,516,429 - 9,527,061 (-)	Ensembl
Rnor_6.0 Ensembl	7	12,382,636 - 12,393,266 (-)	Ensembl

RefSeq Acc Id:

NM_001168670 ⟹ NP_001162141

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	10,167,091 - 10,177,719 (-)	NCBI
mRatBN7.2	7	9,516,429 - 9,527,061 (-)	NCBI
Rnor_6.0	7	12,382,636 - 12,393,266 (-)	NCBI
Rnor_5.0	7	12,552,532 - 12,563,371 (-)	NCBI
RGSC_v3.4	7	11,028,432 - 11,039,064 (-)	RGD
Celera	7	7,692,874 - 7,702,935 (-)	RGD

Sequence:

show sequence

GGGAGAGCGCCTTGCGCAGTGCACCGTTCCGGCCTCTGTCCCGCGCTGCGGCCACCGCCGCCGC
CGCCTGGTTTCTCGGCGCCCGCGGTCTACAGCGGGGGCCGCGCGCAGAGGCGGGGCGGCGGATC
TCCAAGCGCGCGGCGCTCCGCCCGCTCCGCGGCGGAGGCGGAGGCGGAGACGGCGGGGCCAGGC
GGCGGCTGGAGAGCGAGGGAGCGAGCGCGGCGGCAGCACCGGGGCCATGGCGCCCGCGCAGCGC
CCGCTGCTGCCGCTGCTGCTGTTGCTGCTGCCGCTGCGTGCGCGCAACGAGGACCCGGCCCGTG
CCAACGCTGACCGCTACGCAGTCTACTGGAACCGCAGCAACCCCAGGTTTCAGGTGAGCGCTGT
GGGTGATGGCGGCGGCTACACCGTGGAGGTCAGCATCAATGACTACCTGGACATCTATTGCCCG
CACTATGGGGCGCCACTGCCCCCGGCAGAGCGCATGGAACGGTACATCCTATACATGGTGAACG
GCGAGGGCCATGCCTCCTGTGACCACCGGCAGCGAGGCTTCAAGCGCTGGGAATGCAACCGGCC
CGCTGCGCCTGGGGGACCCCTCAAATTCTCCGAGAAGTTCCAACTCTTCACCCCCTTTTCCCTG
GGCTTTGAGTTCCGACCTGGACACGAGTACTACTACATCTCTGCCACACCCCCCAACCTTGTGG
ACCGACCCTGCCTGCGGCTGAAAGTTTACGTGCGTCCAACCAATGAGACCCTGTATGAGGCCCC
AGAGCCCATCTTCACCAGTAACAGCTCCTGCAGCGGCCTGGGTGGCTGCCACCTCTTCCTCACT
ACAGTCCCTGTGCTGTGGTCCCTACTGGGCTCCTAGTGTCCAGCCCCACCTGGACCCCTTGACC
TTCGCCCTCTGACCTGCCACGGCCACCTCCGAGACAAAATCCTTGCTGCTTCTCTTTCATGGTG
CTGTCCCTCCGGAGGAGGCCATCGACCGGTCCCTGGGATGCAACATGGGGTCCCAGTGCCTGAG
ACTGAGATCCAGGCTGAGCCACTTTTGCCAGGACCACCAGGGCCGTCCAGTGTTGTTTGATTAC
GGTCAGAAAGACTTAGGGTTTCTCTTTTAATTTAATTTATTCCCTGATATTGCTGGTGACATTG
GGAAGGAAACAAGTCACAGGGGTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001162141	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD33515	(Get FASTA)	NCBI Sequence Viewer
	EDL89311	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021709.4

RefSeq Acc Id:	NP_001162141 ⟸ NM_001168670
- Peptide Label:	precursor
- UniProtKB:	F1MA19 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPAQRPLLPLLLLLLPLRARNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDY LDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQL FTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSNSSCSGLGG CHLFLTTVPVLWSLLGS hide sequence

Ensembl Acc Id:

ENSRNOP00000021709 ⟸ ENSRNOT00000021709

Protein Domains

Ephrin RBD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1MA19-F1-model_v2	AlphaFold	F1MA19	1-209	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620389	AgrOrtholog
BioCyc Gene	G2FUF-34922	BioCyc
Ensembl Genes	ENSRNOG00000016203	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021709.6	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.420	UniProtKB/TrEMBL
InterPro	Cupredoxin	UniProtKB/TrEMBL
	Ephrin	UniProtKB/TrEMBL
	Ephrin	UniProtKB/TrEMBL
	Ephrin-A_Ecto	UniProtKB/TrEMBL
	Ephrin_CS	UniProtKB/TrEMBL
KEGG Report	rno:84358	UniProtKB/TrEMBL
NCBI Gene	84358	ENTREZGENE
PANTHER	Ephrin	UniProtKB/TrEMBL
	EPHRIN-A2	UniProtKB/TrEMBL
Pfam	Ephrin	UniProtKB/TrEMBL
PhenoGen	Efna2	PhenoGen
PRINTS	EPHRIN	UniProtKB/TrEMBL
PROSITE	EPHRIN	UniProtKB/TrEMBL
	EPHRIN_RBD_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016203	RatGTEx
Superfamily-SCOP	Cupredoxin	UniProtKB/TrEMBL
UniProt	A6K8P1_RAT	UniProtKB/TrEMBL
	F1MA19	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-04-27	Efna2	ephrin A2	Efna2_predicted	ephrin A2 (predicted)	Data merged from RGD:1305946	737654	APPROVED
2005-01-20	Efna2	ephrin A2		ephrin A-2 precursor	Name updated	1299863	APPROVED
2005-01-12	Efna2_predicted	ephrin A2 (predicted)			Symbol and Name status set to approved	70820	APPROVED
2002-08-07	Efna2	ephrin A-2 precursor			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed by primary olfactory axons during the embryonic formation of the olfactory nerve	634733
gene_process	may be involved in axon guidance, neuron-target interactions, regional compartmentalization, and synaptic functions in nervous systems	1300471

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)