Slc8a2 (solute carrier family 8 member A2)

Gene: Slc8a2 (solute carrier family 8 member A2) Rattus norvegicus

Analyze

Symbol:

Slc8a2

Name:

solute carrier family 8 member A2

RGD ID:

620194

Description:

Enables calcium:monoatomic cation antiporter activity involved in regulation of postsynaptic cytosolic calcium ion concentration and calcium:sodium antiporter activity. Involved in monoatomic cation transmembrane transport; response to vitamin D; and telencephalon development. Acts upstream of or within intracellular calcium ion homeostasis. Located in several cellular components, including dendritic spine; microtubule; and neuronal cell body. Is active in postsynaptic membrane. Biomarker of brain ischemia and status epilepticus. Orthologous to human SLC8A2 (solute carrier family 8 member A2); PARTICIPATES IN calcium transport pathway; calcium/calcium-mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; ammonium acetate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

na(+)/Ca(2+)-exchange protein 2; Ncx2; sodium/calcium exchanger 2; solute carrier family 8 (sodium/calcium exchanger), member 2; solute carrier family 8 member 2

RGD Orthologs

Alliance Genes

More Info

more info ...

Allele / Splice:

Slc8a2^m1Mcwi

Genetic Models:

FHH-Slc8a2^m1Mcwi

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	85,944,752 - 85,982,900 (+)	NCBI		GRCr8
mRatBN7.2	1	76,816,583 - 76,852,928 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	76,808,725 - 76,847,072 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	82,196,399 - 82,220,912 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	90,760,423 - 90,784,934 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	83,951,488 - 83,976,005 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	78,029,555 - 78,054,042 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	78,025,995 - 78,060,111 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	79,296,259 - 79,320,746 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	76,473,938 - 76,498,624 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	76,552,048 - 76,576,735 (+)	NCBI
Celera	1	71,312,731 - 71,337,222 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

brain ischemia (IEP)

genetic disease (ISO)

Reperfusion Injury (IEP)

status epilepticus (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

ammonium acetate (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

Brodifacoum (EXP)

butanal (ISO)

calcium atom (EXP)

calcium(0) (EXP)

CGP 52608 (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethanol (ISO)

methoxychlor (EXP)

paracetamol (EXP,ISO)

pentanal (ISO)

phenylmercury acetate (ISO)

propanal (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP,ISO)

Soman (EXP)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium ion export across plasma membrane (IDA,IEA,ISO)

calcium ion homeostasis (IEA)

calcium ion import across plasma membrane (IBA,IDA,IEA)

calcium ion transmembrane transport (IDA,IGI,ISO)

calcium ion transport (IEA)

calcium ion transport into cytosol (IDA)

cell communication (IEA)

cognition (ISO)

intracellular calcium ion homeostasis (IDA,IGI,ISO)

learning (IEA,ISO,ISS)

learning or memory (ISO)

long-term synaptic potentiation (IEA,ISO,ISS)

memory (IEA,ISO,ISS)

modulation of excitatory postsynaptic potential (IEA,ISO)

neuron cellular homeostasis (IEA,ISO)

regulation of action potential firing pattern (IEA,ISO)

regulation of calcineurin-mediated signaling (IEA,ISO)

regulation of cytosolic calcium ion concentration (IEA,ISO)

regulation of gene expression (IEA,ISO)

regulation of postsynaptic cytosolic calcium ion concentration (IEA)

regulation of short-term neuronal synaptic plasticity (IEA,ISO,ISS)

response to ischemia (IEA,ISO)

response to vitamin D (IEP)

sodium ion transmembrane transport (IBA,IDA,IEA,ISO)

sodium ion transport (IDA)

synapse organization (IEA,ISO)

telencephalon development (IEP)

Cellular Component

axon (IBA,IDA,IEA)

axon terminus (IEA,ISO)

basolateral plasma membrane (IEA)

cell projection (IDA)

dendrite (IDA)

dendritic spine (IDA)

microtubule (IDA)

neuronal cell body (IDA)

perikaryon (IEA)

plasma membrane (IEA,ISO,ISS)

postsynapse (IBA,IEA)

postsynaptic density (IEA,ISO)

postsynaptic membrane (IDA)

presynapse (ISO)

sarcolemma (IBA,IEA)

synapse (ISO)

Molecular Function

calcium ion transmembrane transporter activity (ISO)

calcium:monoatomic cation antiporter activity involved in regulation of postsynaptic cytosolic calcium ion concentration (IDA,IMP,NAS)

calcium:sodium antiporter activity (IBA,IDA,IEA,ISO,TAS)

calmodulin binding (IEA)

metal ion binding (IEA)

protein binding (IPI)

sodium ion transmembrane transporter activity (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium transport pathway (ISO)

calcium/calcium-mediated signaling pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Na+/Ca2+ exchanger subtype (NCX1, NCX2, NCX3) protein expression in the rat hippocampus following 3 min and 8 min durations of global cerebral ischemia.	Bojarski C, etal., Brain Res. 2008 Jan 16;1189:198-202. Epub 2007 Nov 1.
2.	Permanent focal brain ischemia induces isoform-dependent changes in the pattern of Na+/Ca2+ exchanger gene expression in the ischemic core, periinfarct area, and intact brain regions.	Boscia F, etal., J Cereb Blood Flow Metab. 2006 Apr;26(4):502-17.
3.	A study of the activity of the plasma membrane Na/Ca exchanger in the cellular environment.	Brini M, etal., Ann N Y Acad Sci 2002 Nov;976:376-81.
4.	High level over-expression of different NCX isoforms in HEK293 cell lines and primary neuronal cultures is protective following oxygen glucose deprivation.	Cross JL, etal., Neurosci Res. 2012 Jul;73(3):191-8. doi: 10.1016/j.neures.2012.04.007. Epub 2012 Apr 27.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Calcium extrusion protein expression in the hippocampal formation of chronic epileptic rats after kainate-induced status epilepticus.	Ketelaars SO, etal., Epilepsia. 2004 Oct;45(10):1189-201.
7.	Sodium-calcium exchangers in rat trigeminal ganglion neurons.	Kuroda H, etal., Mol Pain. 2013 Apr 29;9:22. doi: 10.1186/1744-8069-9-22.
8.	Cloning of the NCX2 isoform of the plasma membrane Na(+)-Ca2+ exchanger.	Li Z, etal., J Biol Chem 1994 Jul 1;269(26):17434-9.
9.	Functional comparison of the three isoforms of the Na+/Ca2+ exchanger (NCX1, NCX2, NCX3).	Linck B, etal., Am J Physiol. 1998 Feb;274(2 Pt 1):C415-23.
10.	Altered gene expression of Na+/Ca2+ exchanger isoforms NCX1, NCX2 and NCX3 in chronic ischemic rat brain.	Lu J, etal., Neurosci Lett 2002 Oct 25;332(1):21-4.
11.	Na+/Ca2+ exchangers: three mammalian gene families control Ca2+ transport.	Lytton J Biochem J. 2007 Sep 15;406(3):365-82.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Cellular and subcellular localization of Na+-Ca2+ exchanger protein isoforms, NCX1, NCX2, and NCX3 in cerebral cortex and hippocampus of adult rat.	Minelli A, etal., Cell Calcium. 2007 Mar;41(3):221-34. Epub 2006 Aug 17.
14.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.	Sodium-calcium exchanger and multiple sodium channel isoforms in intra-epidermal nerve terminals.	Persson AK, etal., Mol Pain. 2010 Nov 30;6:84. doi: 10.1186/1744-8069-6-84.
16.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
17.	Sodium-calcium exchanger NCX1, NCX2, and NCX3 transcripts in developing rat brain.	Polumuri SK, etal., Ann N Y Acad Sci. 2002 Nov;976:60-3.
18.	Inhibitory interaction of the plasma membrane Na+/Ca2+ exchangers with the 14-3-3 proteins.	Pulina MV, etal., J Biol Chem. 2006 Jul 14;281(28):19645-54. Epub 2006 May 5.
19.	GOA pipeline	RGD automated data pipeline
20.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
22.	BHK cells transfected with NCX3 are more resistant to hypoxia followed by reoxygenation than those transfected with NCX1 and NCX2: Possible relationship with mitochondrial membrane potential.	Secondo A, etal., Cell Calcium. 2007 Dec;42(6):521-35. Epub 2007 Mar 6.
23.	High levels of synaptosomal Na(+)-Ca(2+) exchangers (NCX1, NCX2, NCX3) co-localized with amyloid-beta in human cerebral cortex affected by Alzheimer's disease.	Sokolow S, etal., Cell Calcium. 2011 Apr;49(4):208-16. doi: 10.1016/j.ceca.2010.12.008. Epub 2011 Mar 5.
24.	Immunohistochemical detection of the sodium-calcium exchanger in rat hippocampus cultures using subtype-specific antibodies.	Thurneysen T, etal., Ann N Y Acad Sci 2002 Nov;976:367-75.
25.	Expression of epithelial calcium transport system in rat cochlea and vestibular labyrinth.	Yamauchi D, etal., BMC Physiol. 2010 Jan 29;10:1.

Additional References at PubMed

PMID:8798769	PMID:12722103	PMID:12818181	PMID:15541203	PMID:17884163	PMID:22871113	PMID:23403180	PMID:26924806	PMID:27595821	PMID:28428550	PMID:29274751	PMID:29476059
PMID:35114589	PMID:36077454

Genomics

Comparative Map Data

Slc8a2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	85,944,752 - 85,982,900 (+)	NCBI		GRCr8
mRatBN7.2	1	76,816,583 - 76,852,928 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	76,808,725 - 76,847,072 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	82,196,399 - 82,220,912 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	90,760,423 - 90,784,934 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	83,951,488 - 83,976,005 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	78,029,555 - 78,054,042 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	78,025,995 - 78,060,111 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	79,296,259 - 79,320,746 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	76,473,938 - 76,498,624 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	76,552,048 - 76,576,735 (+)	NCBI
Celera	1	71,312,731 - 71,337,222 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

SLC8A2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	47,428,017 - 47,471,893 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	47,428,017 - 47,471,893 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	47,931,274 - 47,975,150 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	52,623,735 - 52,666,934 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	52,623,734 - 52,666,934	NCBI
Celera	19	44,737,047 - 44,781,071 (-)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	44,359,692 - 44,403,467 (-)	NCBI		HuRef
CHM1_1	19	47,933,461 - 47,977,474 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	50,258,872 - 50,302,744 (-)	NCBI		T2T-CHM13v2.0

Slc8a2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	15,861,540 - 15,894,988 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	15,863,751 - 15,894,988 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	16,127,592 - 16,161,063 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	16,129,826 - 16,161,063 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	16,715,649 - 16,745,860 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	15,288,822 - 15,319,033 (+)	NCBI		MGSCv36	mm8
Celera	7	13,328,878 - 13,358,979 (+)	NCBI		Celera
Cytogenetic Map	7	A2	NCBI
cM Map	7	8.75	NCBI

Slc8a2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955574	1,288,952 - 1,315,401 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955574	1,290,907 - 1,315,399 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC8A2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	53,579,183 - 53,623,429 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	55,449,192 - 55,493,420 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	44,420,146 - 44,464,242 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	53,077,028 - 53,119,501 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	53,077,857 - 53,113,830 (-)	Ensembl	panpan1.1		panPan2

SLC8A2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	108,544,825 - 108,575,894 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	108,544,509 - 108,575,891 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	108,026,547 - 108,056,879 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	109,070,843 - 109,101,190 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	109,070,530 - 109,101,924 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	108,737,815 - 108,768,349 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	108,382,587 - 108,412,915 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	109,251,103 - 109,281,451 (+)	NCBI		UU_Cfam_GSD_1.0

Slc8a2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	19,498,414 - 19,521,451 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	1,116,491 - 1,139,586 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936664	1,116,543 - 1,139,586 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC8A2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	53,201,485 - 53,236,513 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	53,201,477 - 53,236,489 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	48,781,798 - 48,816,809 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC8A2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	40,758,106 - 40,803,277 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	40,757,440 - 40,797,126 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	20,492,681 - 20,538,539 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc8a2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	6,333,677 - 6,361,888 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	6,333,672 - 6,359,536 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc8a2
109 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	45
Count of miRNA genes:	41
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000047289
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat

Markers in Region

D1Got72

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	76,832,179 - 76,832,268 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	78,039,154 - 78,039,242	NCBI	Rnor6.0
Rnor_5.0	1	79,305,858 - 79,305,946	UniSTS	Rnor5.0
RGSC_v3.4	1	76,483,534 - 76,483,623	RGD	RGSC3.4
RGSC_v3.4	1	76,483,535 - 76,483,623	UniSTS	RGSC3.4
RGSC_v3.1	1	76,561,646 - 76,561,734	RGD
Celera	1	71,322,332 - 71,322,420	UniSTS
RH 3.4 Map	1	774.3	RGD
RH 3.4 Map	1	774.3	UniSTS
Cytogenetic Map	1	q21	UniSTS

BE106527

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	76,836,128 - 76,836,331 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	78,043,103 - 78,043,305	NCBI	Rnor6.0
Rnor_5.0	1	79,309,807 - 79,310,009	UniSTS	Rnor5.0
RGSC_v3.4	1	76,487,484 - 76,487,686	UniSTS	RGSC3.4
Celera	1	71,326,281 - 71,326,483	UniSTS
RH 3.4 Map	1	771.2	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH137848

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	76,827,325 - 76,827,472 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	78,034,304 - 78,034,450	NCBI	Rnor6.0
Rnor_5.0	1	79,301,008 - 79,301,154	UniSTS	Rnor5.0
RGSC_v3.4	1	76,478,685 - 76,478,831	UniSTS	RGSC3.4
Celera	1	71,317,478 - 71,317,624	UniSTS
RH 3.4 Map	1	777.4	UniSTS
Cytogenetic Map	1	q21	UniSTS

Genetic Models

This gene Slc8a2 is modified in the following models/strains:

FHH-Slc8a2^m1Mcwi

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									62		4
Low	3	7	19	3	17	3	4	5	12	32	31	10	4
Below cutoff		34	19	19	2	19	4	6		3	6	1	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_078619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U08141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000047289 ⟹ ENSRNOP00000042012

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	76,808,725 - 76,847,072 (+)	Ensembl
Rnor_6.0 Ensembl	1	78,029,555 - 78,054,044 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000086396 ⟹ ENSRNOP00000071086

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	76,808,725 - 76,847,072 (+)	Ensembl
Rnor_6.0 Ensembl	1	78,025,995 - 78,060,111 (+)	Ensembl

RefSeq Acc Id:

NM_078619 ⟹ NP_511174

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	85,950,762 - 85,975,250 (+)	NCBI
mRatBN7.2	1	76,822,579 - 76,847,070 (+)	NCBI
Rnor_6.0	1	78,029,555 - 78,054,042 (+)	NCBI
Rnor_5.0	1	79,296,259 - 79,320,746 (+)	NCBI
RGSC_v3.4	1	76,473,938 - 76,498,624 (+)	RGD
Celera	1	71,312,731 - 71,337,222 (+)	RGD

Sequence:

show sequence

ATGGCTCCCTTGGCTTTGGTAGGGGTTGCCCTCCTTCTGGGGGCACCCCACTGCTTGGGGGAAG
CTACTCCGACCCCATCCCTGCCACCTCCCCCAGCTAATGACAGCGATGCCAGCCCAGGCGGCTG
CCAAGGTTCCTACCGCTGCCAACCAGGGGTGCTGCTGCCTGTGTGGGAACCCGACGACCCATCA
CTGGGGGACAAGGCTGCACGGGCCGTGGTGTACTTTGTGGCCATGGTCTACATGTTCTTGGGTC
TGTCTATCATTGCTGATCGTTTTATGGCATCCATTGAGGTCATCACATCCAAGGAGAAAGAGAT
CACCATCACCAAGGCAAATGGGGAGACCAGCGTGGGCACTGTACGCATCTGGAATGAAACGGTG
TCCAACCTTACACTCATGGCCCTGGGCTCCTCAGCACCTGAGATTCTGCTGTCTGTCATCGAGG
TCTGTGGCCACAACTTCCAGGCGGGTGAGCTAGGCCCAGGCACCATCGTGGGCAGTGCCGCCTT
CAACATGTTTGTGGTCATTGCTGTGTGTGTGTATGTCATCCCGGCTGGTGAGAGCCGTAAGATC
AAGCACTTAAGGGTCTTCTTCGTCACAGCCTCTTGGAGCATCTTTGCCTATGTCTGGCTTTATC
TCATTCTAGCAGTTTTCTCTCCAGGCGTGGTCCAGGTGTGGGAGGCACTGCTCACGCTGGTCTT
CTTCCCGGTGTGTGTGGTGTTCGCCTGGATGGCGGACAAGCGACTGCTCTTCTACAAGTACGTG
TACAAGCGCTATCGCACCGACCCTCGCAGCGGAATCATCATCGGGGCAGAGGGAGACCCGCCCA
AGAGCATCGAGCTGGATGGCACATTCGTGGGCACTGAGGTCCCAGGCGAGCTGGGTGCATTGGG
CACAGGTCCCGCTGAGGCGCGTGAGCTGGACGCCAGCCGGCGCGAGGTCATCCAGATTCTTAAG
GACTTAAAGCAGAAGCACCCGGATAAGGACCTGGAGCAGCTGGTGGGCATCGCCAAGTACTATG
CACTGCTGCACCAGCAGAAGAGCCGTGCCTTCTACCGCATCCAGGCCACGCGGCTGATGACAGG
TGCGGGCAACGTGCTGCGCCGACACGCTGCGGATGCTGCCCGCAGGCCTGGGGCCAACGATGGT
GCCCCCGATGATGAGGACGATGGTGCCAGCCGCATCTTCTTTGAGCCCAGCCTCTACCACTGCC
TGGAGAACTGCGGGTCAGTGCTGCTGTCGGTGGCTTGCCAGGGTGGTGAGGGCAACAGCACCTT
CTACGTGGATTACCGCACGGAGGATGGCTCTGCAAAGGCAGGCTCCGATTATGAGTACAGCGAG
GGCACGCTGGTGTTCAAGCCCGGGGAGACGCAGAAGGAGCTGCGCATCGGCATCATCGACGACG
ACATCTTCGAGGAGGACGAGCACTTCTTCGTGAGGCTGCTGAACCTGCGTGTGGGCGATGCTCA
GGGCATGTTCGAGCCCGACGGCGGTGGGCGGCCCAAGGGGCGGCTGGTGGCGCCACTGCTGGCC
ACCGTCACCATTCTGGACGACGACCACGCGGGCATCTTCTCCTTCCAGGACCGCCTGCTGCATG
TGAGCGAGTGCATGGGCACCGTGGATGTGCGTGTGGTGCGCAGCTCTGGCGCACGTGGCACCGT
ACGCCTTCCCTACCGCACAGTGGACGGCACGGCTCGTGGTGGTGGTGTGCACTACGAGGATGCT
TGTGGAGAGCTGGAGTTCGGCGATGACGAGACCATGAAGACTCTTCAGGTCAAGATAGTGGACG
ACGAAGAGTATGAGAAGAAGGACAACTTCTTCATCGAGCTGGGCCAGCCCCAGTGGCTTAAGCG
GGGCATCTCAGCTCTGCTACTCAACCAAGGGGATGGAGACAGGAAGCTGACTGCAGAGGAGGAG
GAGGCCCAGAGGATAGCAGAGATGGGCAAGCCAGTTCTTGGGGAGAACTGTCGCCTCGAGGTCA
TCATCGAGGAGTCTTATGACTTTAAGAATACGGTGGATAAACTCATAAAGAAAACAAACCTGGC
CTTGGTGATTGGGACCCACTCATGGAGGGAGCAGTTTTTAGAGGCAGTTACAGTGAGCGCAGGG
GACGAGGAGGAGGATGAGGATGGGTCTCGTGAGGAGCGGCTGCCATCCTGCTTTGACTACGTGA
TGCACTTCCTGACGGTGTTCTGGAAAGTTCTGTTCGCCTGCCTTCCACCCACGGAGTACTGCCA
TGGCTGGGCCTGCTTTGGTGTCTGCATCCTGGTCATTGGTCTGCTCACTGCCCTCATCGGAGAC
CTGGCCTCACACTTTGGGTGCACCGTGGGCCTCAAGGACTCAGTCAACGCCGTGGTCTTCGTGG
CTCTGGGCACCTCCATCCCTGACACGTTTGCCAGCAAGGTGGCCGCGCTGCAGGACCAGTGCGC
CGACGCGTCCATCGGTAACGTGACCGGCTCCAATGCGGTGAACGTGTTCCTGGGCCTGGGTGTG
GCCTGGTCGGTGGCCGCAGTGTACTGGGCGGTGCAGGGTCGCCCCTTCGAGGTGCGTACAGGCA
CGCTGGCCTTCTCGGTCACACTGTTCACCGTCTTCGCCTTCGTGGGCATCGCAGTGCTCTTGTA
CCGGCGCCGGCCACACATCGGCGGCGAGCTGGGCGGCCCGCGGGGACCCAAGCTAGCCACCACC
GCTCTCTTCCTGGGCCTCTGGTTCCTCTACATTCTCTTCGCCAGCCTGGAGGCTTATTGCCACA
TTCGGGGCTTCTAGGGCCCCAGCCGCTACCCTGAGGGTGGGGACTTGTTGGCACTTGCTCTTGG
ACCCACCCCTGTCTCCCTACCCAGACTCAACCTGGGTACTTCCTAGGCTCCTCCTCATCAGCCT
TCTTCCTGGGATCAGCCTCCCTTTCCCCCTGGAATCCCATCCCTTGCCCTCCCTTCTCAGAGGC
ACCCCCTTCAGCCCATCTTTGTGAGTTACACCTGAGCCCTCTGGCCAGACACCCAGCCCC

hide sequence

RefSeq Acc Id:

XM_039080711 ⟹ XP_038936639

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	85,944,752 - 85,976,369 (+)	NCBI
mRatBN7.2	1	76,816,583 - 76,847,192 (+)	NCBI

RefSeq Acc Id:

XM_039080746 ⟹ XP_038936674

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	85,944,752 - 85,982,900 (+)	NCBI
mRatBN7.2	1	76,816,583 - 76,852,928 (+)	NCBI

RefSeq Acc Id:

XM_063270095 ⟹ XP_063126165

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	85,944,752 - 85,976,369 (+)	NCBI

RefSeq Acc Id:

XM_063270123 ⟹ XP_063126193

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	85,944,752 - 85,976,369 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_511174	(Get FASTA)	NCBI Sequence Viewer
	XP_038936639	(Get FASTA)	NCBI Sequence Viewer
	XP_038936674	(Get FASTA)	NCBI Sequence Viewer
	XP_063126165	(Get FASTA)	NCBI Sequence Viewer
	XP_063126193	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA19920	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000042012.6
	ENSRNOP00000071086
	ENSRNOP00000071086.2
GenBank Protein	P48768	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_511174 ⟸ NM_078619
- Peptide Label:	precursor
- UniProtKB:	P48768 (UniProtKB/Swiss-Prot), A0A0G2JZK7 (UniProtKB/TrEMBL), A6J898 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPLALVGVALLLGAPHCLGEATPTPSLPPPPANDSDASPGGCQGSYRCQPGVLLPVWEPDDPS LGDKAARAVVYFVAMVYMFLGLSIIADRFMASIEVITSKEKEITITKANGETSVGTVRIWNETV SNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVCVYVIPAGESRKI KHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVCVVFAWMADKRLLFYKYV YKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGTEVPGELGALGTGPAEARELDASRREVIQILK DLKQKHPDKDLEQLVGIAKYYALLHQQKSRAFYRIQATRLMTGAGNVLRRHAADAARRPGANDG APDDEDDGASRIFFEPSLYHCLENCGSVLLSVACQGGEGNSTFYVDYRTEDGSAKAGSDYEYSE GTLVFKPGETQKELRIGIIDDDIFEEDEHFFVRLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLA TVTILDDDHAGIFSFQDRLLHVSECMGTVDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDA CGELEFGDDETMKTLQVKIVDDEEYEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEE EAQRIAEMGKPVLGENCRLEVIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAVTVSAG DEEEDEDGSREERLPSCFDYVMHFLTVFWKVLFACLPPTEYCHGWACFGVCILVIGLLTALIGD LASHFGCTVGLKDSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGV AWSVAAVYWAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATT ALFLGLWFLYILFASLEAYCHIRGF hide sequence

RefSeq Acc Id:

ENSRNOP00000071086 ⟸ ENSRNOT00000086396

RefSeq Acc Id:

ENSRNOP00000042012 ⟸ ENSRNOT00000047289

RefSeq Acc Id:	XP_038936674 ⟸ XM_039080746
- Peptide Label:	isoform X3
- UniProtKB:	P48768 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038936639 ⟸ XM_039080711
- Peptide Label:	isoform X1
- UniProtKB:	P48768 (UniProtKB/Swiss-Prot), A0A0G2JZK7 (UniProtKB/TrEMBL), A6J898 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063126193 ⟸ XM_063270123
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063126165 ⟸ XM_063270095
- Peptide Label:	isoform X2
- UniProtKB:	F1M9A2 (UniProtKB/TrEMBL)

Protein Domains

Calx-beta

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P48768-F1-model_v2	AlphaFold	P48768	1-921	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689727

Promoter ID:

EPDNEW_R250

Type:

initiation region

Name:

Slc8a2_1

Description:

solute carrier family 8 member A2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	78,025,991 - 78,026,051	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620194	AgrOrtholog
BioCyc Gene	G2FUF-60622	BioCyc
Ensembl Genes	ENSRNOG00000001492	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000047289.6	UniProtKB/TrEMBL
	ENSRNOT00000086396.2	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1420.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.60.40.2030	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	CalX-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Calx_beta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Na_Ca_Ex	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Na_Ca_Ex_C-exten	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NaCa_Exmemb	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NCX_ion-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:140447	UniProtKB/Swiss-Prot
NCBI Gene	140447	ENTREZGENE
PANTHER	SODIUM/CALCIUM EXCHANGER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SODIUM/CALCIUM EXCHANGER 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Calx-beta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Na_Ca_ex	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Na_Ca_ex_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	SLC8A2	RGD
PhenoGen	Slc8a2	PhenoGen
PRINTS	NACAEXCHNGR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001492	RatGTEx
SMART	Calx_beta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF141072	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JZK7	ENTREZGENE, UniProtKB/TrEMBL
	A6J898	ENTREZGENE, UniProtKB/TrEMBL
	F1M9A2	ENTREZGENE, UniProtKB/TrEMBL
	NAC2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Slc8a2	solute carrier family 8 member A2	Slc8a2	solute carrier family 8 member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-24	Slc8a2	solute carrier family 8 member 2	Slc8a2	solute carrier family 8 (sodium/calcium exchanger), member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Slc8a2	solute carrier family 8 (sodium/calcium exchanger), member 2			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Slc8a2	solute carrier family 8 (sodium/calcium exchanger), member 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expressed in cerebral cortex and hippocampus	727449
gene_protein	protein contains 921 aa residues	730182

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)