Il10ra (interleukin 10 receptor subunit alpha)

Gene: Il10ra (interleukin 10 receptor subunit alpha) Rattus norvegicus

Analyze

Symbol:

Il10ra

Name:

interleukin 10 receptor subunit alpha

RGD ID:

620138

Description:

Enables interleukin-10 binding activity and interleukin-10 receptor activity. Involved in regulation of synapse organization and response to lipopolysaccharide. Predicted to be located in cytosol and plasma membrane. Predicted to be active in apical plasma membrane. Human ortholog(s) of this gene implicated in inflammatory bowel disease 28. Orthologous to human IL10RA (interleukin 10 receptor subunit alpha); PARTICIPATES IN Interleukin-10 signaling pathway; cytokine mediated signaling pathway; Jak-Stat signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

interleukin 10 receptor, alpha; interleukin-10 receptor subunit alpha

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	54,459,754 - 54,474,786 (-)	NCBI		GRCr8
mRatBN7.2	8	45,563,009 - 45,578,041 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	45,563,137 - 45,578,061 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	51,059,536 - 51,072,968 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	49,338,295 - 49,351,727 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	47,208,844 - 47,222,279 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	49,558,062 - 49,573,891 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	49,560,035 - 49,573,742 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	48,184,634 - 48,200,343 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	48,211,040 - 48,224,439 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	48,219,805 - 48,233,205 (-)	NCBI
Celera	8	45,147,695 - 45,161,094 (-)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

CD3epsilon deficiency (ISO)

Chromosome 11, Partial Trisomy 11q (ISO)

COVID-19 (ISO)

Crohn's disease (ISO)

Dwarfism (ISO)

Experimental Autoimmune Encephalomyelitis (IEP)

genetic disease (ISO)

glycogen storage disease Ib (ISO)

immunodeficiency 17 (ISO)

immunodeficiency 18 (ISO)

immunodeficiency 19 (ISO)

inflammatory bowel disease (ISO)

inflammatory bowel disease 28 (ISO)

intellectual disability (ISO)

isolated microphthalmia 5 (ISO)

nephronophthisis 15 (ISO)

RASopathy (ISO)

visceral leishmaniasis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

15-acetyldeoxynivalenol (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrobenzenesulfonic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

9-cis-retinoic acid (ISO)

acetamide (EXP)

all-trans-4-oxoretinoic acid (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

asperentin (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

benzoates (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bleomycin A2 (ISO)

Brevianamide A (ISO)

buta-1,3-diene (ISO)

butanal (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

choline (ISO)

cisplatin (ISO)

clofibrate (ISO)

clopidogrel (ISO)

copper(II) sulfate (ISO)

dexamethasone (ISO)

dimethylarsinic acid (ISO)

diquat (ISO)

diuron (ISO)

ethyl methanesulfonate (ISO)

ferric oxide (ISO)

fluvastatin (ISO)

folic acid (ISO)

formaldehyde (ISO)

glycidol (EXP)

hydroxychloroquine (ISO)

isotretinoin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

lidocaine (EXP)

linuron (ISO)

lipopolysaccharide (ISO)

methapyrilene (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylarsonic acid (ISO)

microcystin-LR (ISO)

mycophenolic acid (ISO)

mycotoxin (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

pentanal (ISO)

raloxifene (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium stibogluconate (ISO)

sulfasalazine (ISO)

teriflunomide (ISO)

testosterone (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

valproic acid (ISO)

vincristine (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytokine-mediated signaling pathway (IBA)

interleukin-10-mediated signaling pathway (ISO)

intestinal epithelial structure maintenance (ISO)

negative regulation of autophagy (ISO)

negative regulation of inflammatory response (ISO)

positive regulation of receptor signaling pathway via JAK-STAT (ISO)

regulation of synapse organization (IMP)

response to lipopolysaccharide (IEP)

ubiquitin-dependent endocytosis (ISO)

Cellular Component

apical plasma membrane (ISO)

cytosol (IEA,ISO)

plasma membrane (IBA,ISO)

Molecular Function

interleukin-10 binding (IMP,IPI)

interleukin-10 receptor activity (IBA,IMP,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cytokine mediated signaling pathway (IEA)

Interleukin-10 signaling pathway (IMP,ISO)

Jak-Stat signaling pathway (IEA)

toxoplasmosis pathway (IEA)

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Site-specific modulation of LPS-induced fever and interleukin-1 beta expression in rats by interleukin-10.	Ledeboer A, etal., Am J Physiol Regul Integr Comp Physiol 2002 Jun;282(6):R1762-72.
4.	Expression and regulation of interleukin-10 and interleukin-10 receptor in rat astroglial and microglial cells.	Ledeboer A, etal., Eur J Neurosci 2002 Oct;16(7):1175-85.
5.	Regional and temporal expression patterns of interleukin-10, interleukin-10 receptor and adhesion molecules in the rat spinal cord during chronic relapsing EAE.	Ledeboer A, etal., J Neuroimmunol. 2003 Mar;136(1-2):94-103.
6.	Neuronal synapse formation induced by microglia and interleukin 10.	Lim SH, etal., PLoS One. 2013 Nov 22;8(11):e81218. doi: 10.1371/journal.pone.0081218. eCollection 2013.
7.	IL-10 receptor and coreceptor expression in quiescent and activated hepatic stellate cells.	Mathurin P, etal., Am J Physiol Gastrointest Liver Physiol 2002 Jun;282(6):G981-90.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	Interleukin-10 regulates progenitor differentiation and modulates neurogenesis in adult brain.	Perez-Asensio FJ, etal., J Cell Sci. 2013 Sep 15;126(Pt 18):4208-19. doi: 10.1242/jcs.127803. Epub 2013 Jul 10.
12.	Interleukin (IL)-10 inhibits RANTES-, tumour necrosis factor (TNF)- and nerve growth factor (NGF)-induced mast cell migratory response but is not a mast cell chemoattractant.	Pietrzak A, etal., Immunol Lett. 2009 Mar 24;123(1):46-51. Epub 2009 Feb 14.
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Comprehensive gene review and curation	RGD comprehensive gene curation
18.	Biology of interleukin-10.	Sabat R, etal., Cytokine Growth Factor Rev. 2010 Oct;21(5):331-44. doi: 10.1016/j.cytogfr.2010.09.002. Epub 2010 Nov 5.
19.	The rat interleukin 10 receptor: cloning and sequencing of cDNA coding for the alpha-chain protein sequence, and demonstration by western blotting of expression in the rat brain.	Ward H, etal., Cytokine 2001 Sep 7;15(5):237-40.

Additional References at PubMed

PMID:16086233	PMID:16982608	PMID:22087322	PMID:23185784	PMID:26962683	PMID:31210303

Genomics

Comparative Map Data

Il10ra
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	54,459,754 - 54,474,786 (-)	NCBI		GRCr8
mRatBN7.2	8	45,563,009 - 45,578,041 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	45,563,137 - 45,578,061 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	51,059,536 - 51,072,968 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	49,338,295 - 49,351,727 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	47,208,844 - 47,222,279 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	49,558,062 - 49,573,891 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	49,560,035 - 49,573,742 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	48,184,634 - 48,200,343 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	48,211,040 - 48,224,439 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	48,219,805 - 48,233,205 (-)	NCBI
Celera	8	45,147,695 - 45,161,094 (-)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

IL10RA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	117,986,394 - 118,003,037 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	117,986,370 - 118,003,037 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	117,857,109 - 117,873,752 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	117,362,319 - 117,377,404 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	117,362,318 - 117,377,404	NCBI
Celera	11	115,014,946 - 115,030,037 (+)	NCBI		Celera
Cytogenetic Map	11	q23.3	NCBI
HuRef	11	113,790,784 - 113,805,875 (+)	NCBI		HuRef
CHM1_1	11	117,742,666 - 117,757,757 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	118,002,773 - 118,019,416 (+)	NCBI		T2T-CHM13v2.0

Il10ra
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	45,165,135 - 45,180,447 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	45,165,135 - 45,180,447 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	45,253,837 - 45,269,149 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	45,253,837 - 45,269,149 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	45,061,922 - 45,077,229 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	45,004,833 - 45,020,128 (-)	NCBI		MGSCv36	mm8
Celera	9	42,530,039 - 42,545,574 (-)	NCBI		Celera
Cytogenetic Map	9	A5.2	NCBI
cM Map	9	24.84	NCBI

Il10ra
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	19,182,029 - 19,193,971 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	19,182,536 - 19,197,083 (+)	NCBI	ChiLan1.0	ChiLan1.0

IL10RA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	118,686,901 - 118,702,056 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	119,791,876 - 119,807,051 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	112,820,445 - 112,835,603 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	116,752,619 - 116,767,771 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	116,752,619 - 116,767,771 (+)	Ensembl	panpan1.1		panPan2

IL10RA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	15,675,775 - 15,688,935 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	15,677,547 - 15,682,163 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	15,725,841 - 15,738,336 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	15,617,611 - 15,630,201 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	15,617,622 - 15,630,212 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	15,755,417 - 15,767,913 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	15,658,874 - 15,671,434 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	15,700,417 - 15,712,914 (-)	NCBI		UU_Cfam_GSD_1.0

Il10ra
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	100,178,025 - 100,191,000 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936542	3,099,430 - 3,113,210 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936542	3,099,484 - 3,113,159 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL10RA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	45,310,534 - 45,325,168 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	45,310,527 - 45,324,557 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	50,364,900 - 50,378,929 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IL10RA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	109,357,081 - 109,372,557 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	109,357,133 - 109,372,697 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	16,683,781 - 16,699,148 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Il10ra
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624784	13,386,965 - 13,403,014 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624784	13,386,793 - 13,399,871 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Il10ra
88 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	46
Interacting mature miRNAs:	46
Transcripts:	ENSRNOT00000021926
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	26644912	46711092	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	27205715	54998217	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	28242912	53961020	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	29502665	50095447	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	58482492	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684993	Bmd84	Bone mineral density QTL 84	4.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	8	42692684	50095447	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1		3		14						2	5
Low	2	25	54	41	5	41	8	10	68	29	28	6	8
Below cutoff		16						1	6	6	11

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_057193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006242864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080716	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ305049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021926 ⟹ ENSRNOP00000021926

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	45,563,137 - 45,578,061 (-)	Ensembl
Rnor_6.0 Ensembl	8	49,560,035 - 49,573,742 (-)	Ensembl

RefSeq Acc Id:

NM_057193 ⟹ NP_476541

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	54,461,387 - 54,474,786 (-)	NCBI
mRatBN7.2	8	45,564,642 - 45,578,041 (-)	NCBI
Rnor_6.0	8	49,560,181 - 49,573,710 (-)	NCBI
Rnor_5.0	8	48,184,634 - 48,200,343 (-)	NCBI
RGSC_v3.4	8	48,211,040 - 48,224,439 (-)	RGD
Celera	8	45,147,695 - 45,161,094 (-)	RGD

Sequence:

show sequence

GCCGGAGGCCTAAAGGCCGGCTCCAGTGGACGATGCCGCTGTGCGCCCAGGATGTTGCCGCGTT
TACTCCCATTCCTCGTCTCGATCTCCAGCCTGAGCCTGGGCTTCCGCGCACACGGGACAGAACT
GCCGAGCCCTTCCTCCGTGTGGTTTGAAGCCAGATTTTTCCAGCACATCCTCCGCTGGATGTCT
ATCCCAAACCAGTCTGAGAGCACCTACTACGAAGTGGCCCTCAAGAAGTACGGAACCTCGGTCT
GGAAAGACATCCACATCTGTAGCAAGGCTCAGACATTGTCCTGCGATCTCACAACGTCCACCCT
AGATCTGTACCACAGCTCTGGCTACCGGGCCAGAGTCCGGGCAGTGGACAACAGTCAGTATTCC
AACTGGACCATCACTGAAACTCGCTTCACAGTGGATGAAGTGATTCTGACGGTGGATAGCGTGA
CGCTGAAAGTAAGCAACGGCTTCATCTACGGGACAATCCATCCCCCCAGGCCCAATTTAGTCCC
TGTAGGTGACGAGTATGAACAGATCTTCACGCACCACCGCATTTACAGGGTTTGCATTCGGAAG
TTCTCAGAACAAAAGAATATAACCAAGACAGTGGAGCAAGAAAACTTCACCCTCGAAGTCCCAA
AAGGGATGAGAAAGTTTTGTGTCAAGGTGATGCCTCACGTGGAATCCCGAATTAACAAGGCAGA
GTGGTCGGAGGAGCAGTGTTTACATGTCACGACGGAGCATTATTTCACCGTGACCAACCTCAGC
ATTTTCTTCTTATCCATCCTGATACTCTGTGGAGCCCTGGTCTGCCTGGTTCTCCTGTGGTACA
TCCGGCACCCGGGGAAGTTACCTGCAGTCCTGGTCTTCGAGAAGCCTCCCGACTTTCTGCTGGC
CAACCCTCGCTGCCCAGAGACTCTCGATGACATTCACATCCTGGACCTGGAGGCCTTCCCAAAG
GTGTCACCCGAGCTGAAAGACTCAGACCTGCATGGCAGCACCGACAGTGGCTTTGGCAGTGGCA
AACCATCACTTCAGACGGAAGAATCCCAATTCTTCCTCCTTGACTCCCACGCCCAGATACAGGA
GACTCTGGGAAAGGAAGGGTCTTCAGAGCTACAGGACACCTGTGGGGACAACACGGACAGTGGG
ATCTGCTTGCAGGAGTCCAGCTTACACTCTAGCATGGGTCCTCCCTGGAAGCAGCAGTTCGGAT
ATACCCACCAGGACCAGGATGACAGTGACCTAGTCCAGAACTCTCCAGGGCATCCTAAGCACAC
ACAGGATGGCTCCGCCTTGGGCCATGGTTGTCTCCTAGAGCCTGAAGTCCCTGAGGAGAAAGAC
CAAGTCATGGTAACGTTCCAGGGCTACCAGAAGCAGACCAGATGGAAGGAGGAAGCAGCAGAAC
CTTTGGACGGAGAGATTCCCTTGGCAGAAGCCTTTGATCCTGAACTCGGGGTGCGCCTGCAGGG
TGATTCAGCTTGGCCTCCTGTGGCTCTAGCCACGGGTTATTTGAAACAGGAGTCTCAAGGGATG
GCCTCTGCTCCACCGGGGACACCAAGTAGACAGTGGAATCAACTGGCTGAGGAATGCTCACTCC
TGGGTGTGGTTAGCTGTGAAGACCTAAGCATAGAGAGTTTGGGTTTTGCCCATGAACTTGTCCC
TCTGGACTGTGGGGCAGCCTCTAGTGGCCTCCTGGATAGCCTTGGCACTAATCTGGTCACCCTG
CCATTGATCTCCAGCCTGCAGATAGAAGAGTGACAGGGGATAAGGTTTCTTTGTATTTTGGCCA
TGCCTGCTCCCCTCCCTATACC

hide sequence

RefSeq Acc Id:

XM_039080716 ⟹ XP_038936644

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	54,459,754 - 54,472,224 (-)	NCBI
mRatBN7.2	8	45,563,009 - 45,575,481 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_476541	(Get FASTA)	NCBI Sequence Viewer
	XP_038936644	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAC24567	(Get FASTA)	NCBI Sequence Viewer
	EDL95358	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021926
	ENSRNOP00000021926.1

RefSeq Acc Id:	NP_476541 ⟸ NM_057193
- Peptide Label:	precursor
- UniProtKB:	G3V830 (UniProtKB/TrEMBL), A6J435 (UniProtKB/TrEMBL), Q99ND6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLPRLLPFLVSISSLSLGFRAHGTELPSPSSVWFEARFFQHILRWMSIPNQSESTYYEVALKKY GTSVWKDIHICSKAQTLSCDLTTSTLDLYHSSGYRARVRAVDNSQYSNWTITETRFTVDEVILT VDSVTLKVSNGFIYGTIHPPRPNLVPVGDEYEQIFTHHRIYRVCIRKFSEQKNITKTVEQENFT LEVPKGMRKFCVKVMPHVESRINKAEWSEEQCLHVTTEHYFTVTNLSIFFLSILILCGALVCLV LLWYIRHPGKLPAVLVFEKPPDFLLANPRCPETLDDIHILDLEAFPKVSPELKDSDLHGSTDSG FGSGKPSLQTEESQFFLLDSHAQIQETLGKEGSSELQDTCGDNTDSGICLQESSLHSSMGPPWK QQFGYTHQDQDDSDLVQNSPGHPKHTQDGSALGHGCLLEPEVPEEKDQVMVTFQGYQKQTRWKE EAAEPLDGEIPLAEAFDPELGVRLQGDSAWPPVALATGYLKQESQGMASAPPGTPSRQWNQLAE ECSLLGVVSCEDLSIESLGFAHELVPLDCGAASSGLLDSLGTNLVTLPLISSLQIEE hide sequence

RefSeq Acc Id:

ENSRNOP00000021926 ⟸ ENSRNOT00000021926

RefSeq Acc Id:	XP_038936644 ⟸ XM_039080716
- Peptide Label:	isoform X1

Protein Domains

Fibronectin type-III Interferon/interleukin receptor

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V830-F1-model_v2	AlphaFold	G3V830	1-569	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695915

Promoter ID:

EPDNEW_R6439

Type:

single initiation site

Name:

Il10ra_1

Description:

interleukin 10 receptor subunit alpha

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	49,573,732 - 49,573,792	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620138	AgrOrtholog
BioCyc Gene	G2FUF-30674	BioCyc
Ensembl Genes	ENSRNOG00000016308	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021926	ENTREZGENE
	ENSRNOT00000021926.5	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
InterPro	Fibronectin_type3	UniProtKB/TrEMBL
	FN3_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Interferon/interleukin_rcp_dom	UniProtKB/TrEMBL
KEGG Report	rno:117539	UniProtKB/TrEMBL
NCBI Gene	117539	ENTREZGENE
PANTHER	INTERFERON/INTERLEUKIN RECEPTOR	UniProtKB/TrEMBL
	INTERLEUKIN-10 RECEPTOR SUBUNIT ALPHA	UniProtKB/TrEMBL
Pfam	Interfer-bind	UniProtKB/TrEMBL
	Tissue_fac	UniProtKB/TrEMBL
PharmGKB	IL10RA	RGD
PhenoGen	Il10ra	PhenoGen
RatGTEx	ENSRNOG00000016308	RatGTEx
Superfamily-SCOP	FN_III-like	UniProtKB/TrEMBL
UniProt	A6J435	ENTREZGENE, UniProtKB/TrEMBL
	G3V830	ENTREZGENE, UniProtKB/TrEMBL
	Q99ND6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-16	Il10ra	interleukin 10 receptor subunit alpha	Il10ra	interleukin 10 receptor, alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Il10ra	interleukin 10 receptor, alpha			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Il10ra	interleukin 10 receptor, alpha			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the cortex, cerebellum, hippocampus, hypothalamus and pituitary	633102
gene_homology	shows 88% and 68% homology with the mouse and human IL-10 receptor	633102
gene_homology	nucleotide sequence is 85% identical to the mouse homolog	625762
gene_regulation	constitutively expressed after in vitro lipopolysaccharide treatment or cholestatic liver injury in activated hepatic stellate cells (HSC)	625762
gene_transcript	RNA transcript is 3.5-kb in hepatic macrophages	625762

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)