Hpn (hepsin) - Rat Genome Database

Name: Hpn
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Hpn (hepsin) Rattus norvegicus

Analyze

Symbol:

Hpn

Name:

hepsin

RGD ID:

61982

Description:

Predicted to enable serine-type endopeptidase activity. Predicted to be involved in several processes, including cochlea morphogenesis; positive regulation of nitrogen compound metabolic process; and regulation of epithelial cell proliferation. Predicted to act upstream of or within cholesterol homeostasis and sensory perception of sound. Predicted to be located in several cellular components, including cell surface; endoplasmic reticulum membrane; and neuronal cell body. Predicted to colocalize with nuclear membrane. Human ortholog(s) of this gene implicated in intellectual disability. Orthologous to human HPN (hepsin); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hepsin (transmembrane protease, serine 1); serine protease hepsin

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HPN (hepsin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Hpn (hepsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hpn (hepsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HPN (hepsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HPN (hepsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hpn (hepsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HPN (hepsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HPN (hepsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hpn (hepsin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	METTL16 (methyltransferase 16, RNA N6-adenosine)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Hpn (hepsin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HPN (hepsin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hpn (hepsin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hpn (hepsin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11836	Alliance	DIOPT (InParanoid\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG18735	Alliance	DIOPT (InParanoid\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG3355	Alliance	DIOPT (InParanoid\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG4386	Alliance	DIOPT (InParanoid\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG4613	Alliance	DIOPT (InParanoid\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG4914	Alliance	DIOPT (InParanoid\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG9294	Alliance	DIOPT (InParanoid\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	hpn	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	95,464,468 - 95,480,169 (-)	NCBI		GRCr8
mRatBN7.2	1	86,337,085 - 86,352,785 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	86,337,087 - 86,352,811 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	91,757,532 - 91,773,231 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	100,223,689 - 100,239,390 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	93,515,821 - 93,531,524 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,534,112 - 89,549,575 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,534,106 - 89,543,967 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,688,659 - 90,704,122 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	86,145,615 - 86,161,091 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	86,223,725 - 86,239,202 (-)	NCBI
Celera	1	80,705,987 - 80,721,634 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brugada syndrome 5 (ISO)

dystonia (ISO)

genetic disease (ISO)

hereditary spastic paraplegia 75 (ISO)

intellectual disability (ISO)

lipid storage disease (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (ISO)

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP)

amiodarone (ISO)

amitriptyline (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

calcitriol (ISO)

chlordecone (ISO)

chlorpromazine (ISO)

ciglitazone (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clofibrate (ISO)

clomipramine (ISO)

clozapine (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (EXP,ISO)

disodium selenite (ISO)

elemental selenium (ISO)

endosulfan (EXP)

erythromycin A (ISO)

flecainide (ISO)

fluoxetine (ISO)

imipramine (ISO)

ketoconazole (ISO)

loratadine (ISO)

methapyrilene (EXP)

methidathion (ISO)

N-Nitrosopyrrolidine (ISO)

nitroglycerin (EXP)

O-methyleugenol (ISO)

oxaliplatin (EXP)

paracetamol (ISO)

paraquat (ISO)

pentamidine (ISO)

perfluorobutyric acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perhexiline (ISO)

pirinixic acid (ISO)

quercetin (ISO)

resveratrol (ISO)

selenium atom (ISO)

selenomethionine (ISO)

sertraline (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tauroursodeoxycholic acid (EXP)

tetrachloromethane (EXP,ISO)

tetracycline (EXP)

thioacetamide (EXP)

thioridazine (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

ursodeoxycholic acid (EXP)

valproic acid (ISO)

zimeldine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

basement membrane disassembly (IEA,ISO,ISS)

cholesterol homeostasis (ISO)

cochlea morphogenesis (ISO,ISS)

detection of mechanical stimulus involved in sensory perception of sound (ISO,ISS)

epithelium development (ISO)

negative regulation of apoptotic process (IEA,ISO,ISS)

negative regulation of epithelial cell proliferation (IEA,ISO,ISS)

negative regulation of epithelial to mesenchymal transition (IBA,IEA,ISO,ISS)

pilomotor reflex (ISO,ISS)

positive regulation by host of viral transcription (IEA,ISS)

positive regulation of cell growth (IEA,ISO,ISS)

positive regulation of gene expression (ISO,ISS)

positive regulation of hepatocyte proliferation (IEA,ISO,ISS)

positive regulation of plasminogen activation (IEA,ISO,ISS)

positive regulation of thyroid hormone generation (ISO,ISS)

potassium ion transmembrane transport (ISO,ISS)

proteolysis (IEA,ISO,ISS)

regulation of cell shape (IBA,IEA,ISO,ISS)

response to thyroid hormone (ISO,ISS)

sensory perception of sound (ISO)

Cellular Component

apical plasma membrane (IEA)

cell surface (IEA,ISO,ISS)

cell-cell junction (ISO,ISS)

cytoplasm (ISS)

endoplasmic reticulum membrane (IEA,ISO,ISS)

membrane (IEA,ISO)

neuronal cell body (ISO,ISS)

nuclear membrane (IEA,ISO,ISS)

plasma membrane (IEA,ISO,ISS)

Molecular Function

peptidase activity (ISO)

protein binding (ISO)

serine-type endopeptidase activity (IEA,ISO)

serine-type exopeptidase activity (IEA)

serine-type peptidase activity (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning and sequence analysis of rat hepsin, a cell surface serine proteinase.	Farley D, etal., Biochim Biophys Acta 1993 Jun 25;1173(3):350-2.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Mutation burden analysis of six common mental disorders in African Americans by whole genome sequencing.	Liu Y, etal., Hum Mol Genet. 2022 Nov 10;31(22):3769-3776. doi: 10.1093/hmg/ddac129.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:1885621	PMID:8346233	PMID:12744720	PMID:15614436	PMID:16908524	PMID:17620368	PMID:17918732	PMID:18784072	PMID:19843851	PMID:19911255	PMID:20683358	PMID:21734266
PMID:22912808	PMID:23376485	PMID:23533145	PMID:24227843

Genomics

Comparative Map Data

Hpn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	95,464,468 - 95,480,169 (-)	NCBI		GRCr8
mRatBN7.2	1	86,337,085 - 86,352,785 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	86,337,087 - 86,352,811 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	91,757,532 - 91,773,231 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	100,223,689 - 100,239,390 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	93,515,821 - 93,531,524 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,534,112 - 89,549,575 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,534,106 - 89,543,967 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,688,659 - 90,704,122 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	86,145,615 - 86,161,091 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	86,223,725 - 86,239,202 (-)	NCBI
Celera	1	80,705,987 - 80,721,634 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

HPN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	35,040,506 - 35,066,573 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	35,040,506 - 35,066,573 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	35,531,410 - 35,557,477 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	40,223,250 - 40,249,315 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	40,223,249 - 40,249,315	NCBI
Celera	19	32,245,008 - 32,271,054 (+)	NCBI		Celera
Cytogenetic Map	19	q13.11	NCBI
HuRef	19	32,039,443 - 32,065,498 (+)	NCBI		HuRef
CHM1_1	19	35,533,351 - 35,559,397 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	37,585,124 - 37,611,169 (+)	NCBI		T2T-CHM13v2.0

Hpn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,798,150 - 30,814,751 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,798,150 - 30,814,715 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	31,098,725 - 31,115,326 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	31,098,725 - 31,115,290 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	31,883,744 - 31,900,309 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,807,485 - 30,824,034 (-)	NCBI		MGSCv36	mm8
Celera	7	25,667,468 - 25,684,520 (-)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	19.3	NCBI

Hpn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	4,384,630 - 4,400,379 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	4,384,630 - 4,399,881 (+)	NCBI	ChiLan1.0	ChiLan1.0

HPN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	41,052,919 - 41,079,073 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,035,320 - 43,062,410 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	31,985,761 - 32,012,841 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	40,725,315 - 40,750,628 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	40,725,319 - 40,750,628 (+)	Ensembl	panpan1.1		panPan2

HPN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	117,486,308 - 117,503,127 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	117,486,340 - 117,502,583 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,886,860 - 116,903,191 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	118,083,712 - 118,100,079 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	118,083,744 - 118,100,024 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	117,646,333 - 117,662,660 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	117,271,725 - 117,288,073 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	118,328,288 - 118,344,658 (-)	NCBI		UU_Cfam_GSD_1.0

Hpn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	10,458,113 - 10,474,937 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	1,170,943 - 1,186,500 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	1,170,951 - 1,186,501 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HPN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	44,608,071 - 44,628,049 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	44,608,076 - 44,628,044 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,033,553 - 40,101,145 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HPN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	29,973,743 - 29,998,701 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	29,973,867 - 29,998,855 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	7,743,680 - 7,768,279 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hpn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	8,421,791 - 8,439,782 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	8,426,005 - 8,439,758 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hpn
113 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	55
Count of miRNA genes:	50
Interacting mature miRNAs:	54
Transcripts:	ENSRNOT00000028644
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat

Markers in Region

U85786

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	86,353,982 - 86,354,124 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	89,550,804 - 89,550,945	NCBI	Rnor6.0
Rnor_5.0	1	90,705,351 - 90,705,492	UniSTS	Rnor5.0
RGSC_v3.4	1	86,162,320 - 86,162,461	UniSTS	RGSC3.4
Celera	1	80,722,863 - 80,723,004	UniSTS
Cytogenetic Map	1	q21	UniSTS

PMC15797P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	86,354,090 - 86,354,306 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	89,550,912 - 89,551,127	NCBI	Rnor6.0
Rnor_5.0	1	90,705,459 - 90,705,674	UniSTS	Rnor5.0
RGSC_v3.4	1	86,162,428 - 86,162,643	UniSTS	RGSC3.4
Celera	1	80,722,971 - 80,723,186	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH131311

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	86,337,107 - 86,337,310 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	89,534,133 - 89,534,335	NCBI	Rnor6.0
Rnor_5.0	1	90,688,680 - 90,688,882	UniSTS	Rnor5.0
RGSC_v3.4	1	86,145,636 - 86,145,838	UniSTS	RGSC3.4
Celera	1	80,706,008 - 80,706,210	UniSTS
RH 3.4 Map	1	843.2	UniSTS
Cytogenetic Map	1	q21	UniSTS

D1Bda14

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	86,337,109 - 86,337,305 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	89,534,135 - 89,534,330	NCBI	Rnor6.0
Rnor_5.0	1	90,688,682 - 90,688,877	UniSTS	Rnor5.0
RGSC_v3.4	1	86,145,638 - 86,145,833	UniSTS	RGSC3.4
Celera	1	80,706,010 - 80,706,205	UniSTS
Cytogenetic Map	1	q21	UniSTS

Hpn

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	86,337,336 - 86,337,410 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	89,534,362 - 89,534,435	NCBI	Rnor6.0
Rnor_5.0	1	90,688,909 - 90,688,982	UniSTS	Rnor5.0
Celera	1	80,706,237 - 80,706,310	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			41	41		41				35	2	1
Low	2	38	6		13		8	11	24		33	10	8
Below cutoff	1	5	10		6				36		6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017112	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282729	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282733	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111870	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072688	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X70900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000028644 ⟹ ENSRNOP00000028644

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	86,337,087 - 86,347,146 (-)	Ensembl
Rnor_6.0 Ensembl	1	89,534,112 - 89,539,210 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000077462 ⟹ ENSRNOP00000074136

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	86,337,087 - 86,352,754 (-)	Ensembl
Rnor_6.0 Ensembl	1	89,534,106 - 89,539,210 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000079631 ⟹ ENSRNOP00000075632

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	86,337,087 - 86,352,754 (-)	Ensembl
Rnor_6.0 Ensembl	1	89,534,416 - 89,543,967 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117697 ⟹ ENSRNOP00000092304

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	86,337,087 - 86,352,811 (-)	Ensembl

RefSeq Acc Id:

NM_017112 ⟹ NP_058808

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,464,470 - 95,480,135 (-)	NCBI
mRatBN7.2	1	86,337,087 - 86,352,754 (-)	NCBI
Rnor_6.0	1	89,534,112 - 89,549,575 (-)	NCBI
Rnor_5.0	1	90,688,659 - 90,704,122 (-)	NCBI
RGSC_v3.4	1	86,145,615 - 86,161,091 (-)	RGD
Celera	1	80,705,987 - 80,721,634 (-)	RGD

Sequence:

show sequence

GCAGGCCCCACGCTGCTGGCTGCTGCTGCCACCCTTGCCTCCCGGGCTGCCCGCTGCTGTGGGG
ACACCATGCCCCTTCCCAGGCCCGGAGACTAACCCCAAACCTGCACCATCTCCGGCGAACCCCA
GGGTTCCGCCCCAGCCCAACAGGTCAACCTGGGAATCATTAACAAGAGTCCCTGACATGGCGAA
GGAGGGTGGCCGGACTGCACCATGCTGTTCCAGACCCAAGGTGGCAGCTCTCACTGTGGGGACC
CTGCTGTTCCTGACAGGCATTGGGGCTGCGTCCTGGGCCATTGTGACCATCCTACTACGGAGTG
ACCAGGAGCCACTGTACCAAGTGCAGCTCAGTCCCGGGGACTCTCGACTTTTGGTGTTGGACAA
GACAGAGGGAACGTGGAGGCTGCTGTGCTCCTCACGCTCCAACGCCAGGGTAGCAGGGCTCGGC
TGTGAGGAGATGGGCTTTCTCAGGGCTCTGGCGCACTCAGAGCTGGATGTGCGAACCGCGGGCG
CCAACGGCACATCGGGCTTCTTCTGCGTGGACGAGGGCGGTCTGCCTCTGGCTCAGCGGTTGCT
GGATGTCATCTCTGTATGCGACTGTCCTAGAGGCCGATTCCTGACTGCCACCTGCCAAGACTGT
GGCCGCAGGAAGCTGCCGGTGGATCGCATTGTGGGGGGCCAGGACAGCAGCCTGGGAAGATGGC
CATGGCAGGTCAGCCTGCGTTATGATGGGACCCACCTCTGTGGGGGATCCCTGCTGTCCGGGGA
CTGGGTACTGACCGCTGCACACTGCTTTCCAGAGAGGAACCGGGTCCTGTCTCGGTGGCGAGTA
TTTGCTGGTGCTGTAGCCCGGACCTCACCTCATGCCGTGCAGCTGGGGGTTCAGGCTGTGATCT
ATCATGGGGGCTACCTTCCCTTTCGAGACCCTACTATCGACGAAAACAGCAATGACATTGCCCT
GGTCCACCTCTCTAGCTCCCTGCCTCTCACAGAATACATCCAGCCGGTTTGTCTCCCTGCTGCG
GGACAGGCCCTGGTGGACGGCAAGGTCTGTACAGTGACCGGCTGGGGTAACACACAGTTCTATG
GCCAGCAAGCTGTGGTGCTCCAAGAGGCCCGGGTCCCCATCATAAGCAACGAAGTTTGCAACAG
CCCCGACTTCTACGGGAATCAGATCAAACCCAAGATGTTCTGTGCTGGCTATCCTGAGGGTGGT
ATTGATGCATGCCAGGGTGACAGCGGAGGCCACTTTGTATGTGAGGACAGAATCTCTGGAACAT
CAAGATGGCGGCTCTGCGGCATTGTAAGCTGGGGTACGGGCTGTGCTTTGGCCCGGAAGCCGGG
AGTGTACACCAAAGTCATTGACTTCCGGGAGTGGATCTTCCAGGCCATAAAGACTCACTCCGAA
GCTACCGGCATGGTAACTCAGCCCTGACCCCGCCTCATCGCCTGCTCCGCGCTGCTCCAGCATC
CAGAGTCAGAGTTGGTCTGGTGGCTCCAGCCGCACGTGGCAGGCTCCACACTGGGCCTCACATG
GAACGGTTTTCTGCTCGGATCCAGTCCATAGATCCAAGGATGCTGGGTCCAAGGACCTCTCTTC
CACAGTGGCCGGCCCACTCAATCCCAGGGCCATTGGCCTCACCCTCCCACCCCATGTAAATATT
ACTCTGTCCTCTGGGGGCTGCTTTCGAGGCGCCCCTTGTGCGGATGCTCTTTAAATAATAAAGG
TGGTTTTGATT

hide sequence

RefSeq Acc Id:

XM_039102958 ⟹ XP_038958886

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,464,468 - 95,480,168 (-)	NCBI
mRatBN7.2	1	86,337,085 - 86,352,780 (-)	NCBI

RefSeq Acc Id:

XM_039102973 ⟹ XP_038958901

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,464,468 - 95,480,166 (-)	NCBI
mRatBN7.2	1	86,337,085 - 86,352,775 (-)	NCBI

RefSeq Acc Id:

XM_039102979 ⟹ XP_038958907

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,464,468 - 95,480,165 (-)	NCBI
mRatBN7.2	1	86,337,085 - 86,352,785 (-)	NCBI

RefSeq Acc Id:

XM_039102984 ⟹ XP_038958912

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,464,674 - 95,480,168 (-)	NCBI
mRatBN7.2	1	86,337,085 - 86,352,780 (-)	NCBI

RefSeq Acc Id:

XM_039102995 ⟹ XP_038958923

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,464,717 - 95,480,169 (-)	NCBI
mRatBN7.2	1	86,337,328 - 86,352,782 (-)	NCBI

RefSeq Acc Id:

XM_063282727 ⟹ XP_063138797

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,464,468 - 95,479,511 (-)	NCBI

RefSeq Acc Id:

XM_063282728 ⟹ XP_063138798

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,464,468 - 95,480,167 (-)	NCBI

RefSeq Acc Id:

XM_063282729 ⟹ XP_063138799

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,464,468 - 95,479,509 (-)	NCBI

RefSeq Acc Id:

XM_063282733 ⟹ XP_063138803

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	95,464,468 - 95,480,167 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_058808	(Get FASTA)	NCBI Sequence Viewer
	XP_038958886	(Get FASTA)	NCBI Sequence Viewer
	XP_038958901	(Get FASTA)	NCBI Sequence Viewer
	XP_038958907	(Get FASTA)	NCBI Sequence Viewer
	XP_038958912	(Get FASTA)	NCBI Sequence Viewer
	XP_038958923	(Get FASTA)	NCBI Sequence Viewer
	XP_063138797	(Get FASTA)	NCBI Sequence Viewer
	XP_063138798	(Get FASTA)	NCBI Sequence Viewer
	XP_063138799	(Get FASTA)	NCBI Sequence Viewer
	XP_063138803	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH72688	(Get FASTA)	NCBI Sequence Viewer
	CAA50256	(Get FASTA)	NCBI Sequence Viewer
	EDM07664	(Get FASTA)	NCBI Sequence Viewer
	EDM07665	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028644.7
	ENSRNOP00000074136.2
	ENSRNOP00000075632
	ENSRNOP00000075632.2
	ENSRNOP00000092304
	ENSRNOP00000092304.1
GenBank Protein	Q05511	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_058808 ⟸ NM_017112
- Peptide Label:	precursor
- UniProtKB:	Q05511 (UniProtKB/Swiss-Prot), F1LS97 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAKEGGRTAPCCSRPKVAALTVGTLLFLTGIGAASWAIVTILLRSDQEPLYQVQLSPGDSRLLV LDKTEGTWRLLCSSRSNARVAGLGCEEMGFLRALAHSELDVRTAGANGTSGFFCVDEGGLPLAQ RLLDVISVCDCPRGRFLTATCQDCGRRKLPVDRIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLL SGDWVLTAAHCFPERNRVLSRWRVFAGAVARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSND IALVHLSSSLPLTEYIQPVCLPAAGQALVDGKVCTVTGWGNTQFYGQQAVVLQEARVPIISNEV CNSPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGHFVCEDRISGTSRWRLCGIVSWGTGCALAR KPGVYTKVIDFREWIFQAIKTHSEATGMVTQP hide sequence

RefSeq Acc Id:

ENSRNOP00000075632 ⟸ ENSRNOT00000079631

RefSeq Acc Id:

ENSRNOP00000028644 ⟸ ENSRNOT00000028644

RefSeq Acc Id:

ENSRNOP00000074136 ⟸ ENSRNOT00000077462

RefSeq Acc Id:	XP_038958907 ⟸ XM_039102979
- Peptide Label:	isoform X6
- UniProtKB:	A0A8I6AHA6 (UniProtKB/TrEMBL), F1LS97 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958912 ⟸ XM_039102984
- Peptide Label:	isoform X7
- UniProtKB:	F1LS97 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958886 ⟸ XM_039102958
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038958901 ⟸ XM_039102973
- Peptide Label:	isoform X5
- UniProtKB:	F1LS97 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958923 ⟸ XM_039102995
- Peptide Label:	isoform X7
- UniProtKB:	F1LS97 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000092304 ⟸ ENSRNOT00000117697

RefSeq Acc Id:	XP_063138803 ⟸ XM_063282733
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063138798 ⟸ XM_063282728
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063138797 ⟸ XM_063282727
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063138799 ⟸ XM_063282729
- Peptide Label:	isoform X3

Protein Domains

Peptidase S1 SRCR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q05511-F1-model_v2	AlphaFold	Q05511	1-416	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61982	AgrOrtholog
BioCyc Gene	G2FUF-60046	BioCyc
Ensembl Genes	ENSRNOG00000021097	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028644.7	UniProtKB/TrEMBL
	ENSRNOT00000077462.2	UniProtKB/TrEMBL
	ENSRNOT00000079631	ENTREZGENE
	ENSRNOT00000079631.2	UniProtKB/TrEMBL
	ENSRNOT00000117697.1	UniProtKB/TrEMBL
Gene3D-CATH	2.40.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.10.250.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7098661	IMAGE-MGC_LOAD
InterPro	Hepsin-SRCR_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_S1_PA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_S1_PA_chymotrypsin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_S1A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SRCR-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SRCR-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Trypsin_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRYPSIN_HIS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRYPSIN_SER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29135	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91742	IMAGE-MGC_LOAD
NCBI Gene	29135	ENTREZGENE
PANTHER	ACROSIN-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HYALIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SERINE PROTEASE HEPSIN	UniProtKB/TrEMBL
	TRANSMEMBRANE PROTEASE SERINE	UniProtKB/TrEMBL
Pfam	Hepsin-SRCR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Trypsin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hpn	PhenoGen
PRINTS	CHYMOTRYPSIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	TRYPSIN_DOM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRYPSIN_HIS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRYPSIN_SER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000021097	RatGTEx
SMART	SM00202	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tryp_SPc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50494	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF56487	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC232122
UniProt	A0A0G2K7B4_RAT	UniProtKB/TrEMBL
	A0A0G2KB31_RAT	UniProtKB/TrEMBL
	A0A8I6AHA6	ENTREZGENE, UniProtKB/TrEMBL
	A6JA69_RAT	UniProtKB/TrEMBL
	F1LS97	ENTREZGENE, UniProtKB/TrEMBL
	HEPS_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6GQQ3_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-02-26	Hpn	hepsin	Hpn	hepsin (transmembrane protease, serine 1)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Hpn	hepsin (transmembrane protease, serine 1)	Hpn	hepsin	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Hpn	hepsin			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_homology	88.7% amino acid sequence identity to human homolog	61628
gene_protein	416 amino acids	61628

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD