Mtpn (myotrophin) - Rat Genome Database

Name: Mtpn
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Mtpn (myotrophin) Rattus norvegicus

Analyze

Symbol:

Mtpn

Name:

myotrophin

RGD ID:

619806

Description:

Enables sequence-specific DNA binding activity. Involved in several processes, including cellular response to mechanical stimulus; cerebellar granule cell differentiation; and positive regulation of macromolecule metabolic process. Located in axon; cytosol; and nucleus. Used to study hypertension. Biomarker of hypertension. Orthologous to human MTPN (myotrophin); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Gcdp; granule cell differentiation protein; growth factor; MGC108675; protein V-1; stimulates myocyte growth; V-1 protein

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MTPN (myotrophin)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mtpn (myotrophin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mtpn (myotrophin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MTPN (myotrophin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MTPN (myotrophin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mtpn (myotrophin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MTPN (myotrophin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MTPN (myotrophin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mtpn (myotrophin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Mtpn (myotrophin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MTPN (myotrophin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mtpn (myotrophin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31715	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C43H6.3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7423	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mtpn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	65,126,390 - 65,153,803 (-)	NCBI		GRCr8
mRatBN7.2	4	64,159,273 - 64,186,686 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	64,157,641 - 64,186,724 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	69,116,325 - 69,143,737 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	65,026,060 - 65,053,436 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	63,434,435 - 63,461,845 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	63,012,009 - 63,039,422 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	63,012,011 - 63,039,422 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	62,732,736 - 62,760,149 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	62,896,762 - 62,924,175 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	63,171,383 - 63,200,312 (-)	NCBI
Celera	4	59,206,334 - 59,233,762 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Chemical and Drug Induced Liver Injury (ISO)

dilated cardiomyopathy (ISO)

genetic disease (ISO)

hypertension (IDA,IEP)

pleomorphic xanthoastrocytoma (ISO)

Right Ventricular Hypertrophy (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

benzene (EXP)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

clofibrate (EXP)

cocaine (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dextran sulfate (ISO)

Di-n-octyl phthalate (ISO)

dibutyl phthalate (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (EXP,ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

FR900359 (ISO)

gentamycin (EXP)

hypochlorous acid (ISO)

methamphetamine (EXP)

methidathion (ISO)

methimazole (EXP)

Methylazoxymethanol acetate (EXP)

methylmercury(1+) (EXP)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

p-toluidine (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

poly(I:C) (EXP)

resveratrol (ISO)

SB 431542 (ISO)

sulfadimethoxine (EXP)

sulindac (EXP)

T-2 toxin (EXP)

temozolomide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

tributylstannane (EXP)

trichloroethene (EXP)

trimellitic anhydride (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

catecholamine metabolic process (IEP)

cellular response to mechanical stimulus (IEP)

cerebellar granule cell differentiation (IEP)

neuron differentiation (NAS)

positive regulation of cardiac muscle hypertrophy (IMP,ISO)

positive regulation of cell growth (IDA)

positive regulation of macromolecule biosynthetic process (IDA)

positive regulation of protein metabolic process (IDA)

regulation of barbed-end actin filament capping (IBA,IEA,ISO,ISS)

regulation of cell size (ISO)

skeletal muscle tissue regeneration (IEP)

striated muscle cell differentiation (IEP)

Cellular Component

axon (IDA)

cytoplasm (IBA,IEA,ISO)

cytosol (IDA)

F-actin capping protein complex (ISO)

nucleus (IBA,IDA,IEA)

perinuclear region of cytoplasm (IEA)

Molecular Function

protein binding (IPI)

sequence-specific DNA binding (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Characterization and functional significance of myotrophin: a gene with multiple transcripts.	Adhikary G, etal., Gene. 2005 Jun 20;353(1):31-40.
2.	cDNA sequence and characterization of the gene that encodes human myotrophin/V-1 protein, a mediator of cardiac hypertrophy.	Anderson KM, etal., J Mol Cell Cardiol. 1999 Apr;31(4):705-19.
3.	Nuclear co-translocation of myotrophin and p65 stimulates myocyte growth. Regulation by myotrophin hairpin loops.	Das B, etal., J Biol Chem. 2008 Oct 10;283(41):27947-56. doi: 10.1074/jbc.M801210200. Epub 2008 Aug 7.
4.	Down-regulation of an ankyrin repeat-containing protein, V-1, during skeletal muscle differentiation and its re-expression in the regenerative process of muscular dystrophy.	Furukawa Y, etal., Neuromuscul Disord 2003 Jan;13(1):32-41.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Myotrophin-kappaB DNA interaction in the initiation process of cardiac hypertrophy.	Gupta S and Sen S, Biochim Biophys Acta. 2002 May 8;1589(3):247-60.
7.	Glucocorticoid inhibits expression of V-1, a catecholamine biosynthesis regulatory protein, in cultured adrenal medullary cells.	Hiwatashi Y, etal., FEBS Lett 2002 Sep 25;528(1-3):166-70.
8.	Intracellular cAMP controls a physical association of V-1 with CapZ in cultured mammalian endocrine cells.	Kitazawa M, etal., Biochem Biophys Res Commun. 2005 May 27;331(1):181-6.
9.	Myotrophin/V-1 does not act as an extracellular signal to induce myocyte hypertrophy.	Knuefermann P, etal., Tex Heart Inst J. 2006;33(3):281-9.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Myotrophin in human cardiomyopathic heart.	Sil P, etal., Circ Res. 1993 Jul;73(1):98-108.
15.	Cardiac myotrophin exhibits rel/NF-kappa B interacting activity in vitro.	Sivasubramanian N, etal., J Biol Chem 1996 Feb 2;271(5):2812-6.
16.	Enhanced expression of GTP cyclohydrolase I in V-1-overexpressing PC12D cells.	Suzuki T, etal., Biochem Biophys Res Commun 2002 May 10;293(3):962-8.
17.	A rat cerebellar protein containing the cdc10/SWI6 motif.	Taoka M, etal., Eur J Biochem 1992 Jul 15;207(2):615-20.
18.	Murine cerebellar neurons express a novel gene encoding a protein related to cell cycle control and cell fate determination proteins.	Taoka M, etal., J Biol Chem 1994 Apr 1;269(13):9946-51.
19.	Expression of V-1, a novel catecholamine biosynthesis regulatory protein, is enhanced by hypertension in atrial myocytes of Dahl salt-sensitive rats.	Yamakuni T, etal., Biochem Biophys Res Commun 2002 Nov 15;298(5):793-7.
20.	V-1, a catecholamine biosynthesis regulatory protein, positively controls catecholamine secretion in PC12D cells.	Yamakuni T, etal., FEBS Lett 2002 Oct 23;530(1-3):94-8.

Additional References at PubMed

PMID:9194197	PMID:9634699	PMID:12079376	PMID:12477932	PMID:12488317	PMID:15489334	PMID:15532712	PMID:16895918	PMID:17113103	PMID:23376485

Genomics

Comparative Map Data

Mtpn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	65,126,390 - 65,153,803 (-)	NCBI		GRCr8
mRatBN7.2	4	64,159,273 - 64,186,686 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	64,157,641 - 64,186,724 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	69,116,325 - 69,143,737 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	65,026,060 - 65,053,436 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	63,434,435 - 63,461,845 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	63,012,009 - 63,039,422 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	63,012,011 - 63,039,422 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	62,732,736 - 62,760,149 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	62,896,762 - 62,924,175 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	63,171,383 - 63,200,312 (-)	NCBI
Celera	4	59,206,334 - 59,233,762 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

MTPN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	135,926,760 - 135,977,359 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	135,926,760 - 135,977,359 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	135,611,508 - 135,662,107 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	135,262,049 - 135,312,604 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	130,348,855 - 130,399,560 (-)	NCBI		Celera
Cytogenetic Map	7	q33	NCBI
HuRef	7	129,914,553 - 129,965,190 (-)	NCBI		HuRef
CHM1_1	7	135,545,252 - 135,596,008 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	137,233,963 - 137,284,569 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	134,955,940 - 135,006,645 (-)	NCBI

Mtpn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	35,485,759 - 35,516,823 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	35,485,841 - 35,516,823 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	35,508,824 - 35,539,888 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	35,508,906 - 35,539,888 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	35,458,824 - 35,489,888 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	35,439,058 - 35,469,939 (-)	NCBI		MGSCv36	mm8
Celera	6	35,501,209 - 35,532,303 (-)	NCBI		Celera
Cytogenetic Map	6	B1	NCBI
cM Map	6	15.27	NCBI

Mtpn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955494	6,805,262 - 6,845,394 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955494	6,805,518 - 6,844,454 (+)	NCBI	ChiLan1.0	ChiLan1.0

MTPN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	172,750,521 - 172,801,562 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	24,760,776 - 24,811,817 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	127,896,148 - 127,947,122 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	140,392,620 - 140,443,591 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	140,392,620 - 140,443,591 (-)	Ensembl	panpan1.1		panPan2

MTPN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	12,316,487 - 12,369,148 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	12,316,336 - 12,369,387 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	13,329,142 - 13,381,817 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	12,291,590 - 12,344,263 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	12,291,377 - 12,347,409 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	12,738,681 - 12,791,312 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	11,837,732 - 11,890,481 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	11,977,207 - 12,029,889 (+)	NCBI		UU_Cfam_GSD_1.0

Mtpn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	18,540,208 - 18,575,185 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936592	644,430 - 679,800 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936592	644,618 - 679,615 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MTPN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	13,330,029 - 13,395,460 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	13,330,049 - 13,395,297 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	14,099,754 - 14,137,565 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MTPN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	104,605,924 - 104,657,664 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	104,605,592 - 104,657,866 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666072	1,494,997 - 1,544,426 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mtpn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624765	16,181,809 - 16,218,720 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624765	16,182,691 - 16,218,634 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mtpn
57 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	838
Count of miRNA genes:	321
Interacting mature miRNAs:	405
Transcripts:	ENSRNOT00000015808
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	39505275	73892441	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	39524264	74726312	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	56647776	78882945	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	56647776	78882945	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	56647776	78882945	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	56647776	78882945	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	81266970	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114705	78881294	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	58432133	92991462	Rat
631671	Iddm11	Insulin dependent diabetes mellitus QTL 11	3.6	0.0012	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	58635877	78886137	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62879517	107879517	Rat
7394826	Bw126	Body weight QTL 126		0.002	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	62933269	87483707	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	62933508	82490359	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in mean arterial blood pressure (CMO:0002035)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in systolic blood pressure (CMO:0000747)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in pulse pressure (CMO:0001882)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat

Markers in Region

RH134386

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	64,159,517 - 64,159,714 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	63,012,254 - 63,012,450	NCBI	Rnor6.0
Rnor_5.0	4	62,732,981 - 62,733,177	UniSTS	Rnor5.0
RGSC_v3.4	4	62,897,007 - 62,897,203	UniSTS	RGSC3.4
Celera	4	59,206,579 - 59,206,775	UniSTS
RH 3.4 Map	4	398.1	UniSTS
Cytogenetic Map	4	q22	UniSTS

RH142541

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	64,166,104 - 64,166,213 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	63,018,841 - 63,018,949	NCBI	Rnor6.0
Rnor_5.0	4	62,739,568 - 62,739,676	UniSTS	Rnor5.0
RGSC_v3.4	4	62,903,594 - 62,903,702	UniSTS	RGSC3.4
Celera	4	59,213,182 - 59,213,290	UniSTS
RH 3.4 Map	4	400.9	UniSTS
Cytogenetic Map	4	q22	UniSTS

RH135242

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	64,157,781 - 64,157,989 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	63,010,518 - 63,010,725	NCBI	Rnor6.0
Rnor_5.0	4	62,731,245 - 62,731,452	UniSTS	Rnor5.0
RGSC_v3.4	4	62,895,271 - 62,895,478	UniSTS	RGSC3.4
Celera	4	59,204,843 - 59,205,050	UniSTS
RH 3.4 Map	4	402.5	UniSTS
RH 3.4 Map	4	394.9	UniSTS
Cytogenetic Map	4	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	42	57	41	19	41	8	10	74	35	41	11	8
Low		1						1
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024374	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY951952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D26179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U21661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000015808 ⟹ ENSRNOP00000015808

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	64,157,641 - 64,186,724 (-)	Ensembl
Rnor_6.0 Ensembl	4	63,012,011 - 63,039,422 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103488 ⟹ ENSRNOP00000082083

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	64,157,643 - 64,186,664 (-)	Ensembl

RefSeq Acc Id:

NM_024374 ⟹ NP_077350

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	65,126,390 - 65,153,803 (-)	NCBI
mRatBN7.2	4	64,159,273 - 64,186,686 (-)	NCBI
Rnor_6.0	4	63,012,009 - 63,039,422 (-)	NCBI
Rnor_5.0	4	62,732,736 - 62,760,149 (-)	NCBI
RGSC_v3.4	4	62,896,762 - 62,924,175 (-)	RGD
Celera	4	59,206,334 - 59,233,762 (-)	RGD

Sequence:

show sequence

CGCTAGCCGCGGCCCACAGTCTCGCCCGCTCGGCTGCCTGAGGCACGTCGTTTCCTCGTGTCCT
TCGTCGGGCGTAATCGCCGCTTCTGCCCGACCCGCCGGCCCATCCCGCTGCAGTGATGTGCGAC
AAGGAGTTCATGTGGGCCCTGAAAAACGGAGACTTGGATGAGGTGAAGGACTATGTGGCTAAGG
GAGAAGATGTCAACCGGACACTAGAGGGTGGGAGGAAGCCTCTTCACTATGCTGCAGATTGTGG
ACAGCTTGAAATCCTGGAATTTCTGCTGCTGAAAGGAGCAGATATTAATGCTCCAGATAAACAT
CATATCACCCCTCTTCTGTCTGCTGTCTATGAGGGTCATGTTTCCTGTGTGAAATTGCTTCTGT
CAAAGGGTGCTGATAAGACTGTGAAAGGCCCAGATGGACTGACCGCCCTTGAAGCCACTGACAA
CCAGGCAATCAAAGCTCTTCTCCAGTGATGGATGGATGGACTGATAACTTGGGAAGAATGACTC
TCCTGTGGCCTCACACTGCTGCCTGTCTGTCTGTCACTTTCTATCTGCCAGCTTCTTCAGCTAA
ATACTTTAAGAGGGTGAAGGGAGAGAGAAATTCATAACAAATCAGACTGCCAGGGGGGAATTAA
ACATGTTTTGGAGGAGCAGTGGGGAATGTGATGAGACTTTTACTGGGATTCCTGAACAAACCAG
CCTGTTTTTCATTTCCAGTAAAATATACAGCTTATACCCAAGGGAGAGCAGAAATACCGTCTGC
TGGAATCCTTGGACCTTCTCAGCTCCCTAGTGATTTCTTAATTAGTGTACTGAAGGTCTGGCCA
CACAAGGCCAACTCTTCCTATTTGGTGGCCCTAGCTGTGAGCAGTAGTGGCTGCTGTTCTGTCA
ACTTAGGGTGCTGAGATAAGCAATTAGCTCCAGCCTTCCTTCTGCCTTAAGAATGCACTCTCCT
GGGGGCTCCTGGCTGGTTAAGAGCGCTGCCTGCAGTTAGTGACCAAAACCTCTCTCGAATGACT
TTAGTCTTTATGTAAGAGCTTAGATAAGGTTAGGAGCAGCGCACTCCTCAATTGCTGGATGACT
AAACTTTGGATTTTCTCTCCCCTTTCACATCAATTTCATGTCTCTTTTAGATAAAACTGACTAG
TTTTATTTATAAAATGTTAAATTCTAGGAGCCTAAAGGAGGAACCATTCCAGTAGGCTGATTTC
TTTTTTCTCCTTTAGACTCAGACATTTATATAACATTGAAACACTTTGAGACTCCTTCTGGTAG
TAAAGGAGATTTAAAAATAAAATCATAGCCATAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_077350	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52498	(Get FASTA)	NCBI Sequence Viewer
	AAH88136	(Get FASTA)	NCBI Sequence Viewer
	AAX54865	(Get FASTA)	NCBI Sequence Viewer
	BAA05167	(Get FASTA)	NCBI Sequence Viewer
	EDM15330	(Get FASTA)	NCBI Sequence Viewer
	EDM15331	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015808.6
	ENSRNOP00000082083
	ENSRNOP00000082083.1
	ENSRNOP00055045417
	ENSRNOP00060034508
	ENSRNOP00065021718
GenBank Protein	P62775	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_077350 ⟸ NM_024374
- UniProtKB:	Q58HB3 (UniProtKB/Swiss-Prot), P62775 (UniProtKB/Swiss-Prot), A6IEP4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAP DKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ hide sequence

RefSeq Acc Id:

ENSRNOP00000015808 ⟸ ENSRNOT00000015808

RefSeq Acc Id:

ENSRNOP00000082083 ⟸ ENSRNOT00000103488

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62775-F1-model_v2	AlphaFold	P62775	1-118	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692963

Promoter ID:

EPDNEW_R3487

Type:

initiation region

Name:

Mtpn_1

Description:

myotrophin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	63,039,502 - 63,039,562	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619806	AgrOrtholog
BioCyc Gene	G2FUF-45241	BioCyc
Ensembl Genes	ENSRNOG00000011857	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055031761	UniProtKB/Swiss-Prot
	ENSRNOG00060024042	UniProtKB/Swiss-Prot
	ENSRNOG00065016558	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015808.8	UniProtKB/TrEMBL
	ENSRNOT00000103488	ENTREZGENE
	ENSRNOT00000103488.1	UniProtKB/Swiss-Prot
	ENSRNOT00055054970	UniProtKB/Swiss-Prot
	ENSRNOT00060041642	UniProtKB/Swiss-Prot
	ENSRNOT00065027595	UniProtKB/Swiss-Prot
Gene3D-CATH	1.25.40.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7377576	IMAGE-MGC_LOAD
InterPro	Ankyrin_rpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ankyrin_rpt-contain_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:79215	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:108675	IMAGE-MGC_LOAD
NCBI Gene	79215	ENTREZGENE
PANTHER	MYOTROPHIN	UniProtKB/Swiss-Prot
	MYOTROPHIN	UniProtKB/Swiss-Prot
	MYOTROPHIN	UniProtKB/TrEMBL
	MYOTROPHIN	UniProtKB/TrEMBL
Pfam	Ank_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Mtpn	PhenoGen
PRINTS	ANKYRIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ANK_REP_REGION	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ANK_REPEAT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011857	RatGTEx
	ENSRNOG00055031761	RatGTEx
	ENSRNOG00060024042	RatGTEx
	ENSRNOG00065016558	RatGTEx
SMART	ANK	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48403	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2Q8F1_RAT	UniProtKB/TrEMBL
	A6IEP4	ENTREZGENE, UniProtKB/TrEMBL
	MTPN_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q58HB3	ENTREZGENE
UniProt Secondary	P80144	UniProtKB/Swiss-Prot
	Q58HB3	UniProtKB/Swiss-Prot
	Q9DCN8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Mtpn	myotrophin			Symbol and Name status set to approved	625702	APPROVED
2003-11-13	Mtpn	myotrophin	Gcdp	V-1 protein	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	PROVISIONAL
2002-08-07	Gcdp	V-1 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in chromaffin cells, cerebellum	625450
gene_expression	transient increase in expression is seen during early postnatal development	625450
gene_other	a good marker for early stage of muscle regeneration	632798
gene_process	may regulate expression of catecholamine-synthesizing enzymes	625450
gene_product	member of the ankyrin repeat-containing protein family	632798
gene_protein	117 amino acids	625450
gene_transcript	contains a cdc10/SW16 motif	625450

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD