Pla2g1b (phospholipase A2 group IB)

Gene: Pla2g1b (phospholipase A2 group IB) Rattus norvegicus

Analyze

Symbol:

Pla2g1b

Name:

phospholipase A2 group IB

RGD ID:

61949

Description:

Enables calcium-dependent phospholipase A2 activity and signaling receptor binding activity. Involved in fatty acid biosynthetic process; phospholipid metabolic process; and positive regulation of cell population proliferation. Located in cell surface and secretory granule. Orthologous to human PLA2G1B (phospholipase A2 group IB); PARTICIPATES IN alpha-linolenic acid metabolic pathway; arachidonic acid metabolic pathway; ether lipid metabolic pathway; INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

group IB phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B; phospholipase A2; phospholipase A2 group 1B; phospholipase A2 group IB pancreas; phospholipase A2, group 1B; phospholipase A2, group IB; phospholipase A2, group IB, pancreas

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PLA2G1B (phospholipase A2 group IB)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pla2g1b (phospholipase A2, group IB, pancreas)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pla2g1b (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PLA2G1B (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PLA2G1B (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pla2g1b (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PLA2G1B (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PLA2G1B (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pla2g1b (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RIMBP2 (RIMS binding protein 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Pla2g1b (phospholipase A2, group IB, pancreas)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PLA2G1B (phospholipase A2 group IB)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pla2g1b (phospholipase A2, group IB (pancreas))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C07E3.9	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pla2g1b	Alliance	DIOPT (OMA\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pla2g1bl	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	46,802,932 - 46,814,511 (-)	NCBI		GRCr8
mRatBN7.2	12	41,142,193 - 41,151,967 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,142,200 - 41,153,226 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	42,309,232 - 42,318,815 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	42,922,891 - 42,932,482 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	41,983,439 - 41,993,027 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	46,879,346 - 46,890,234 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	46,879,343 - 46,889,082 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	48,676,465 - 48,687,835 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	42,405,475 - 42,415,189 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	42,268,862 - 42,278,577 (-)	NCBI
Celera	12	42,765,520 - 42,775,233 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Insulin Resistance (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-methoxyethanol (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

calcium atom (ISO)

calcium(0) (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

cycloheximide (ISO)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

dimethylarsinic acid (ISO)

ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO)

flavonoids (ISO)

genistein (EXP)

hydrazine (ISO)

irinotecan (EXP)

iron atom (EXP)

iron(0) (EXP)

lead diacetate (EXP,ISO)

N-methyl-4-phenylpyridinium (ISO)

nitrofen (EXP)

nitroglycerin (EXP)

O-methyleugenol (ISO)

ozone (EXP)

paracetamol (ISO)

perfluorononanoic acid (ISO)

propanal (ISO)

pyrrolidine dithiocarbamate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sulfasalazine (ISO)

sulforaphane (ISO)

testosterone (EXP)

titanium dioxide (EXP,ISO)

trichloroethene (EXP)

triptonide (ISO)

vanadyl sulfate (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antibacterial humoral response (IEA)

antimicrobial humoral immune response mediated by antimicrobial peptide (IEA,ISO)

arachidonic acid secretion (IEA,ISO)

cellular response to insulin stimulus (ISO,ISS)

defense response to Gram-positive bacterium (IEA)

fatty acid biosynthetic process (IBA,IDA,IEA,ISO)

innate immune response in mucosa (IEA,ISO)

intracellular signal transduction (ISO)

leukotriene biosynthetic process (ISO)

lipid catabolic process (IEA,ISO)

neutrophil chemotaxis (ISO)

neutrophil mediated immunity (ISO)

phosphatidylcholine metabolic process (IEA,ISO)

phosphatidylglycerol metabolic process (IEA,ISO,ISS)

phospholipid metabolic process (IBA,IDA)

positive regulation of calcium ion transport into cytosol (ISO)

positive regulation of cell population proliferation (IDA,ISO)

positive regulation of fibroblast proliferation (IBA,IEA,ISO)

positive regulation of immune response (ISO)

positive regulation of interleukin-8 production (ISO)

positive regulation of podocyte apoptotic process (IEA,ISO,ISS)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of glucose import (ISO,ISS)

regulation of interleukin-1 production (ISO)

Cellular Component

cell surface (IDA,IEA,ISO)

extracellular region (ISO)

extracellular space (IEA,ISO)

secretory granule (IDA)

Molecular Function

bile acid binding (ISO,ISS)

calcium ion binding (IBA,IEA,ISO)

calcium-dependent phospholipase A2 activity (IBA,IDA,IEA,ISO)

phospholipase A2 activity (IDA,ISO)

phospholipid binding (IBA,IEA)

protein binding (ISO)

signaling receptor binding (IBA,IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

alpha-linolenic acid metabolic pathway (IEA)

arachidonic acid metabolic pathway (IEA)

ether lipid metabolic pathway (IEA)

Fc epsilon receptor mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

glycerophospholipid metabolic pathway (IEA)

gonadotropin-releasing hormone signaling pathway (IEA)

linoleic acid metabolic pathway (IEA)

long term depression (IEA)

mitogen activated protein kinase signaling pathway (IEA)

toxoplasmosis pathway (IEA)

vascular endothelial growth factor signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Novel proliferative effect of phospholipase A2 in Swiss 3T3 cells via specific binding site.	Arita H, etal., J Biol Chem. 1991 Oct 15;266(29):19139-41.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Protection against diet-induced obesity and obesity- related insulin resistance in Group 1B PLA2-deficient mice.	Huggins KW, etal., Am J Physiol Endocrinol Metab 2002 Nov;283(5):E994-E1001.
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Dog and rat pancreatic phospholipases A2: complete amino acid sequences deduced from complementary DNAs.	Ohara O, etal., J Biochem (Tokyo) 1986 Mar;99(3):733-9.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	Type IB secretory phospholipase A2 is contained in insulin secretory granules of pancreatic islet beta-cells and is co-secreted with insulin from glucose-stimulated islets.	Ramanadham S, etal., Biochim Biophys Acta. 1998 Feb 23;1390(3):301-12.
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Biosynthesis of anandamide and N-palmitoylethanolamine by sequential actions of phospholipase A2 and lysophospholipase D.	Sun YX, etal., Biochem J 2004 Jun 15;380(Pt 3):749-56.
15.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:1420353	PMID:2909239	PMID:6501264	PMID:7060561	PMID:7721806	PMID:7925459	PMID:10066760	PMID:10531313	PMID:11830583	PMID:12860195	PMID:15528384	PMID:16005851
PMID:16392040	PMID:17434532	PMID:17603006	PMID:25335547

Genomics

Comparative Map Data

Pla2g1b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	46,802,932 - 46,814,511 (-)	NCBI		GRCr8
mRatBN7.2	12	41,142,193 - 41,151,967 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,142,200 - 41,153,226 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	42,309,232 - 42,318,815 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	42,922,891 - 42,932,482 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	41,983,439 - 41,993,027 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	46,879,346 - 46,890,234 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	46,879,343 - 46,889,082 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	48,676,465 - 48,687,835 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	42,405,475 - 42,415,189 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	42,268,862 - 42,278,577 (-)	NCBI
Celera	12	42,765,520 - 42,775,233 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

PLA2G1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	120,322,115 - 120,327,779 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	120,322,115 - 120,327,779 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	120,759,918 - 120,765,582 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	119,244,297 - 119,249,975 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	119,222,634 - 119,228,312	NCBI
Celera	12	120,393,029 - 120,398,697 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	117,768,236 - 117,773,905 (-)	NCBI		HuRef
CHM1_1	12	120,727,838 - 120,733,516 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	120,309,295 - 120,314,955 (-)	NCBI		T2T-CHM13v2.0

Pla2g1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	115,604,201 - 115,612,781 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	115,604,321 - 115,612,781 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	115,466,142 - 115,474,722 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	115,466,262 - 115,474,722 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	115,916,275 - 115,924,726 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	115,727,265 - 115,735,716 (+)	NCBI		MGSCv36	mm8
Celera	5	112,565,302 - 112,573,926 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	56.1	NCBI

Pla2g1b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	11,308,643 - 11,316,254 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955455	11,308,848 - 11,316,245 (+)	NCBI	ChiLan1.0	ChiLan1.0

PLA2G1B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	128,383,401 - 128,390,125 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	128,379,778 - 128,386,493 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	117,896,729 - 117,900,946 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	121,270,082 - 121,275,740 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	121,270,082 - 121,275,740 (-)	Ensembl	panpan1.1		panPan2

PLA2G1B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	16,248,417 - 16,257,163 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	16,248,409 - 16,257,178 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	16,252,273 - 16,261,019 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	16,515,905 - 16,524,689 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	16,515,897 - 16,524,704 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	16,476,786 - 16,485,567 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	16,553,497 - 16,562,238 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	16,594,969 - 16,603,767 (-)	NCBI		UU_Cfam_GSD_1.0

Pla2g1b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	146,109,953 - 146,118,171 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936668	610,716 - 616,982 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936668	608,848 - 616,982 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLA2G1B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	40,314,520 - 40,322,315 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	40,314,520 - 40,322,315 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	42,821,332 - 42,829,127 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLA2G1B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	115,670,353 - 115,677,003 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	115,670,344 - 115,677,080 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	129,426,080 - 129,433,036 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pla2g1b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	13,322,675 - 13,329,926 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	13,322,095 - 13,329,928 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pla2g1b
67 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	52
Interacting mature miRNAs:	53
Transcripts:	ENSRNOT00000001525
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Markers in Region

RH128935

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High											1
Medium			5	5	8	5					14	11
Low	3	16	28	16	8	16	5	5	56	13	23		5
Below cutoff		16	18	16	1	16	3	3	17	19	3		3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271231	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D00036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001525 ⟹ ENSRNOP00000001525

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	41,142,200 - 41,153,226 (-)	Ensembl
Rnor_6.0 Ensembl	12	46,879,343 - 46,889,082 (-)	Ensembl

RefSeq Acc Id:

NM_031585 ⟹ NP_113773

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,802,939 - 46,812,653 (-)	NCBI
mRatBN7.2	12	41,142,200 - 41,151,915 (-)	NCBI
Rnor_6.0	12	46,879,353 - 46,889,067 (-)	NCBI
Rnor_5.0	12	48,676,465 - 48,687,835 (-)	NCBI
RGSC_v3.4	12	42,405,475 - 42,415,189 (-)	RGD
Celera	12	42,765,520 - 42,775,233 (-)	RGD

Sequence:

show sequence

CCCTCGCCAAGATGAAACTCCTTCTGCTGGCTGCTTTGCTCACAGCAGGCGTTACTGCACACAG
CATCAGCACTCGGGCTGTGTGGCAGTTCCGCAATATGATCAAGTGCACCATCCCCGGGAGTGAT
CCCCTGAGGGAGTACAACAACTACGGCTGCTACTGTGGCTTGGGCGGCTCAGGCACCCCAGTGG
ACGACTTAGACAGGTGCTGCCAGACTCATGACCACTGCTACAATCAGGCCAAGAAGCTGGAAAG
CTGTAAATTCCTCATCGACAACCCCTACACCAACACGTACTCATACAAGTGCTCCGGGAACGTG
ATCACCTGCAGCGACAAAAACAACGACTGTGAGAGCTTCATCTGCAACTGTGACCGGCAGGCCG
CCATCTGTTTCTCCAAGGTCCCCTACAACAAGGAATACAAAGACCTTGACACCAAGAAACACTG
TTAGGCTGTCACCCCACTTCCTGTCTATGCCGTCCCCGCTCCCCTTGCTGTCTTATTTCTGCAC
CGCACCCTCTAATAAAGTACCAGCAGAAAG

hide sequence

RefSeq Acc Id:

XM_008769222 ⟹ XP_008767444

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,802,932 - 46,814,511 (-)	NCBI
mRatBN7.2	12	41,142,193 - 41,151,967 (-)	NCBI
Rnor_6.0	12	46,879,346 - 46,890,234 (-)	NCBI

Sequence:

show sequence

CTGTCTCTGCTAGGCCGTGCCACCACTGCTGATTCGTGTTTGCTCTGCTGACTCTACCAAACTG
GGCTGCTGGTGTCACTGTGAGGGGTTTGTGAGTGGACCGAGCTGCCGCTGCTGACCTGTGAACT
GAACCGCTGGTTTCCTGACAACAAAGATGGGAGCTGCTCCAAAGAACCTTTCTAAACAGGCAAA
TCCCTCTGGATTGTTCCCTGATAGACCCAAGGCCAGCCCAGAGTGGCTAAGAGCAAAGCAAACA
GCCTTATCTCGGGAGAGTGGGGCCCCAGCTATAAAGAGGGAAAGTCACTTGAGTTCTTCCCTCG
CCCAAGATGAAACTCCTTCTGCTGGCTGCTTTGCTCACAGGCGTTACTGCACACAGCATCAGCA
CTCGGGCTGTGTGGCAGTTCCGCAATATGATCAAGTGCACCATCCCCGGGAGTGATCCCCTGAG
GGAGTACAACAACTACGGCTGCTACTGTGGCTTGGGCGGCTCAGGCACCCCAGTGGACGACTTA
GACAGGTGCTGCCAGACTCATGACCACTGCTACAATCAGGCCAAGAAGCTGGAAAGCTGTAAAT
TCCTCATCGACAACCCCTACACCAACACGTACTCATACAAGTGCTCCGGGAACGTGATCACCTG
CAGCGACAAAAACAACGACTGTGAGAGCTTCATCTGCAACTGTGACCGGCAGGCCGCCATCTGT
TTCTCCAAGGTCCCCTACAACAAGGAATACAAAGACCTTGACACCAAGAAACACTGTTAGGCTG
TCACCCCACTTCCTGTCTATGCCGTCCCCGCTCCCCTTGCTGTCTTATTTCTGCACCGCACCCT
CTAATAAAGTACCAGCAGAAAGAAAGAAA

hide sequence

RefSeq Acc Id:

XM_063271231 ⟹ XP_063127301

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,802,932 - 46,814,511 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_113773	(Get FASTA)	NCBI Sequence Viewer
	XP_008767444	(Get FASTA)	NCBI Sequence Viewer
	XP_063127301	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA00024	(Get FASTA)	NCBI Sequence Viewer
	EDM13878	(Get FASTA)	NCBI Sequence Viewer
	EDM13879	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001525
	ENSRNOP00000001525.2
GenBank Protein	P04055	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113773 ⟸ NM_031585
- Peptide Label:	precursor
- UniProtKB:	P04055 (UniProtKB/Swiss-Prot), A6J1T9 (UniProtKB/TrEMBL), A6J1U0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKLLLLAALLTAGVTAHSISTRAVWQFRNMIKCTIPGSDPLREYNNYGCYCGLGGSGTPVDDLD RCCQTHDHCYNQAKKLESCKFLIDNPYTNTYSYKCSGNVITCSDKNNDCESFICNCDRQAAICF SKVPYNKEYKDLDTKKHC hide sequence

RefSeq Acc Id:	XP_008767444 ⟸ XM_008769222
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2PYZ4 (UniProtKB/TrEMBL), A6J1U0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKLLLLAALLTGVTAHSISTRAVWQFRNMIKCTIPGSDPLREYNNYGCYCGLGGSGTPVDDLDR CCQTHDHCYNQAKKLESCKFLIDNPYTNTYSYKCSGNVITCSDKNNDCESFICNCDRQAAICFS KVPYNKEYKDLDTKKHC hide sequence

RefSeq Acc Id:

ENSRNOP00000001525 ⟸ ENSRNOT00000001525

RefSeq Acc Id:	XP_063127301 ⟸ XM_063271231
- Peptide Label:	isoform X1

Protein Domains

Phospholipase A2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P04055-F1-model_v2	AlphaFold	P04055	1-146	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698689

Promoter ID:

EPDNEW_R9214

Type:

multiple initiation site

Name:

Pla2g1b_1

Description:

phospholipase A2 group IB

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	46,889,066 - 46,889,126	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61949	AgrOrtholog
BioCyc Gene	G2FUF-18994	BioCyc
BioCyc Pathway	PWY-7409 [phospholipid remodeling (phosphatidylethanolamine, yeast)]	BioCyc
	PWY-7416 [phospholipid remodeling (phosphatidylcholine, yeast)]	BioCyc
	PWY-7417 [phospholipid remodeling (phosphatidate, yeast)]	BioCyc
	PWY-7783 [plasmalogen degradation]	BioCyc
	PWY-8053 [anandamide biosynthesis II]	BioCyc
	PWY66-394 [aspirin triggered resolvin E biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7409	BioCyc
	PWY-7416	BioCyc
	PWY-7417	BioCyc
	PWY-7783	BioCyc
	PWY-8053	BioCyc
	PWY66-394	BioCyc
Ensembl Genes	ENSRNOG00000001153	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001525.4	UniProtKB/TrEMBL
Gene3D-CATH	1.20.90.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	PLipase_A2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PLipase_A2_Asp_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PLipase_A2_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PLipase_A2_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PLipase_A2_His_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29526	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	29526	ENTREZGENE
PANTHER	PHOSPHOLIPASE A2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11716	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Phospholip_A2_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pla2g1b	PhenoGen
PRINTS	PHPHLIPASEA2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	PA2_ASP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PA2_HIS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001153	RatGTEx
SMART	PA2c	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48619	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC218877
UniProt	A0A8L2PYZ4	ENTREZGENE, UniProtKB/TrEMBL
	A6J1T9	ENTREZGENE, UniProtKB/TrEMBL
	A6J1U0	ENTREZGENE, UniProtKB/TrEMBL
	P04055	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-30	Pla2g1b	phospholipase A2 group IB	Pla2g1b	phospholipase A2, group IB, pancreas	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	Pla2g1b	phospholipase A2, group IB, pancreas	Pla2g1b	phospholipase A2, group IB	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Pla2g1b	phospholipase A2, group 1B			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

BioCyc Pathways