Pou3f4 (POU class 3 homeobox 4) - Rat Genome Database

Name: Pou3f4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Pou3f4 (POU class 3 homeobox 4) Rattus norvegicus

Analyze

Symbol:

Pou3f4

Name:

POU class 3 homeobox 4

RGD ID:

61947

Description:

Enables DNA-binding transcription factor activity; double-stranded DNA binding activity; and minor groove of adenine-thymine-rich DNA binding activity. Involved in transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Human ortholog(s) of this gene implicated in X-linked deafness 2. Orthologous to human POU3F4 (POU class 3 homeobox 4); INTERACTS WITH 6-propyl-2-thiouracil; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

brain-4; brain-specific homeobox/POU domain protein 4; brn-4; oct-9; octamer-binding protein 9; octamer-binding transcription factor 9; OTF-9; POU domain, class 3, transcription factor 4; RHS2; RHS2 class III POU protein

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POU3F4 (POU class 3 homeobox 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pou3f4 (POU domain, class 3, transcription factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pou3f4 (POU class 3 homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POU3F4 (POU class 3 homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POU3F4 (POU class 3 homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pou3f4 (POU class 3 homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POU3F4 (POU class 3 homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POU3F4 (POU class 3 homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pou3f4 (POU class 3 homeobox 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ABHD16A (abhydrolase domain containing 16A, phospholipase)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Pou3f4 (POU domain, class 3, transcription factor 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	POU3F4 (POU class 3 homeobox 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YOX1	Alliance	DIOPT (Hieranoid\|OrthoFinder)
Caenorhabditis elegans (roundworm):	ceh-6	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	vvl	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pou3f4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	79,974,808 - 79,976,085 (+)	NCBI		GRCr8
mRatBN7.2	X	75,858,646 - 75,859,923 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	75,858,646 - 75,859,923 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	77,428,273 - 77,429,550 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	80,870,563 - 80,871,840 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	78,451,380 - 78,452,657 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	82,143,789 - 82,145,066 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	82,143,789 - 82,145,066 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	82,301,578 - 82,302,855 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	99,214,446 - 99,215,723 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	99,287,906 - 99,289,156 (+)	NCBI
Celera	X	77,112,524 - 77,113,801 (+)	NCBI		Celera
Cytogenetic Map	X	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

Deafness (ISO)

genetic disease (ISO)

high grade glioma (ISO)

syndromic X-linked intellectual disability Lubs type (ISO)

X-linked deafness 2 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-pantothenic acid (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

glycidol (EXP)

methimazole (EXP)

pirinixic acid (EXP,ISO)

rotenone (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cochlea morphogenesis (ISO,ISS)

forebrain neuron differentiation (ISO)

inner ear development (ISO)

negative regulation of mesenchymal cell apoptotic process (ISO,ISS)

regulation of transcription by RNA polymerase II (IBA)

sensory perception of sound (ISO)

transcription by RNA polymerase II (IDA)

Cellular Component

nucleoplasm (IEA,ISO)

Molecular Function

DNA-binding transcription factor activity (IDA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

double-stranded DNA binding (IDA)

minor groove of adenine-thymine-rich DNA binding (IDA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The molecular basis of X-linked deafness type 3 (DFN3) in two sporadic cases: identification of a somatic mosaicism for a POU3F4 missense mutation.	de Kok YJ, etal., Hum Mutat. 1997;10(3):207-11.
2.	Association between X-linked mixed deafness and mutations in the POU domain gene POU3F4.	de Kok YJ, etal., Science. 1995 Feb 3;267(5198):685-8.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	POU domain transcription factor brain 4 confers pancreatic alpha-cell-specific expression of the proglucagon gene through interaction with a novel proximal promoter G1 element.	Hussain MA, etal., Mol Cell Biol. 1997 Dec;17(12):7186-94.
6.	RHS2, a POU domain-containing gene, and its expression in developing and adult rat.	Le Moine C and Young WS 3rd, Proc Natl Acad Sci U S A 1992 Apr 15;89(8):3285-9.
7.	Brain 4: a novel mammalian POU domain transcription factor exhibiting restricted brain-specific expression.	Mathis JM, etal., EMBO J 1992 Jul;11(7):2551-61.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9105675	PMID:9889200	PMID:10587581	PMID:10868931	PMID:14681019	PMID:15574296	PMID:15655183	PMID:17141158	PMID:18231833	PMID:18831054	PMID:20105446	PMID:21663595
PMID:26060893	PMID:31518606

Genomics

Comparative Map Data

Pou3f4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	79,974,808 - 79,976,085 (+)	NCBI		GRCr8
mRatBN7.2	X	75,858,646 - 75,859,923 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	75,858,646 - 75,859,923 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	77,428,273 - 77,429,550 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	80,870,563 - 80,871,840 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	78,451,380 - 78,452,657 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	82,143,789 - 82,145,066 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	82,143,789 - 82,145,066 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	82,301,578 - 82,302,855 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	99,214,446 - 99,215,723 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	99,287,906 - 99,289,156 (+)	NCBI
Celera	X	77,112,524 - 77,113,801 (+)	NCBI		Celera
Cytogenetic Map	X	q31	NCBI

POU3F4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	83,508,290 - 83,512,127 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	83,508,290 - 83,512,127 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	82,763,298 - 82,767,135 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	82,649,941 - 82,651,431 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	82,569,445 - 82,570,920	NCBI
Celera	X	83,000,650 - 83,002,156 (+)	NCBI		Celera
Cytogenetic Map	X	q21.1	NCBI
HuRef	X	76,337,125 - 76,338,589 (+)	NCBI		HuRef
CHM1_1	X	82,657,165 - 82,658,671 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	81,941,865 - 81,945,703 (+)	NCBI		T2T-CHM13v2.0

Pou3f4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	109,857,985 - 109,862,714 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	109,857,886 - 109,860,813 (+)	Ensembl		GRCm39 Ensembl
GRCm38	X	110,814,379 - 110,819,108 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	110,814,280 - 110,817,207 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	108,009,804 - 108,010,889 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	107,017,184 - 107,018,269 (+)	NCBI		MGSCv36	mm8
Celera	X	97,632,784 - 97,633,869 (+)	NCBI		Celera
Cytogenetic Map	X	E1	NCBI
cM Map	X	48.2	NCBI

Pou3f4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955529	2,726,133 - 2,727,218 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955529	2,726,121 - 2,727,311 (+)	NCBI	ChiLan1.0	ChiLan1.0

POU3F4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	82,964,178 - 82,968,669 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	82,967,786 - 82,972,282 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	72,563,887 - 72,568,233 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	82,666,699 - 82,668,337 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	82,666,757 - 82,667,842 (+)	Ensembl	panpan1.1		panPan2

POU3F4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	64,427,161 - 64,428,825 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	64,427,325 - 64,428,410 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	55,185,767 - 55,187,326 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	65,745,624 - 65,747,183 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	65,745,693 - 65,746,778 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	63,406,449 - 63,408,008 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	65,024,007 - 65,025,564 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	64,613,109 - 64,614,668 (+)	NCBI		UU_Cfam_GSD_1.0

Pou3f4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	58,133,789 - 58,135,350 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936547	4,454,297 - 4,455,382 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936547	4,454,239 - 4,455,460 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POU3F4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	66,765,105 - 66,766,190 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	66,765,044 - 66,766,642 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	76,477,799 - 76,479,225 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POU3F4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	72,379,656 - 72,381,186 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	72,379,979 - 72,381,064 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666067	8,524,912 - 8,526,260 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pou3f4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624852	5,037,373 - 5,040,139 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624852	5,036,585 - 5,040,160 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pou3f4
2 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	38
Count of miRNA genes:	33
Interacting mature miRNAs:	38
Transcripts:	ENSRNOT00000003724
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61430	Cia18	Collagen induced arthritis QTL 18	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	14843113	120568734	Rat
1598837	Memor13	Memory QTL 13	3.2		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	41052407	146860749	Rat
738035	Stresp1	Stress response QTL 1	4.96	0.000011	stress-related behavior trait (VT:0010451)	defensive burying - coping	X	41304447	112935181	Rat
61431	Cia19	Collagen induced arthritis QTL 19	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	65612192	120568734	Rat
724551	Glom1	Glomerulus QTL 1	2.8	0.0004	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	X	75294106	120294106	Rat

Markers in Region

AU049792

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	75,859,919 - 75,860,082 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	82,145,063 - 82,145,225	NCBI	Rnor6.0
Rnor_5.0	X	82,302,852 - 82,303,014	UniSTS	Rnor5.0
RGSC_v3.4	X	99,215,720 - 99,215,882	UniSTS	RGSC3.4
Celera	X	77,113,798 - 77,113,960	UniSTS
Cytogenetic Map	X	q31	UniSTS

Pou3f4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	75,858,711 - 75,859,140 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	82,143,855 - 82,144,283	NCBI	Rnor6.0
Rnor_5.0	X	82,301,644 - 82,302,072	UniSTS	Rnor5.0
RGSC_v3.4	X	99,214,512 - 99,214,940	UniSTS	RGSC3.4
Celera	X	77,112,590 - 77,113,018	UniSTS
Cytogenetic Map	X	q31	UniSTS

Pou3f4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	75,858,764 - 75,859,739 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	82,143,908 - 82,144,882	NCBI	Rnor6.0
Rnor_5.0	X	82,301,697 - 82,302,671	UniSTS	Rnor5.0
RGSC_v3.4	X	99,214,565 - 99,215,539	UniSTS	RGSC3.4
Celera	X	77,112,643 - 77,113,617	UniSTS
Cytogenetic Map	X	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hepatobiliary system	nervous system	renal system	reproductive system
High
Medium						45
Low			2	2	2	29	10	6
Below cutoff	1	16	5	4	4		21	19

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M84645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z11834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000003724 ⟹ ENSRNOP00000003724

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	75,858,646 - 75,859,923 (+)	Ensembl
Rnor_6.0 Ensembl	X	82,143,789 - 82,145,066 (+)	Ensembl

RefSeq Acc Id:

NM_017252 ⟹ NP_058948

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	79,974,808 - 79,976,085 (+)	NCBI
mRatBN7.2	X	75,858,646 - 75,859,923 (+)	NCBI
Rnor_6.0	X	82,143,789 - 82,145,066 (+)	NCBI
Rnor_5.0	X	82,301,578 - 82,302,855 (+)	NCBI
RGSC_v3.4	X	99,214,446 - 99,215,723 (+)	RGD
Celera	X	77,112,524 - 77,113,801 (+)	RGD

Sequence:

show sequence

ACATTATAACTAGTAGAGGATCCTCATCGACCATGGCCACAGCTGCCTCGAATCCCTACAGCAT
TCTCAGTTCCAGCTCCCTCGTCCATGCGGACTCTGCGGGCATGCAGCAGGGAAGTCCTTTCCGC
AATCCTCAGAAACTTCTCCAAAGTGACTACTTGCAGGGAGTTCCCAGCAATGGGCATCCCCTCG
GGCATCACTGGGTGACCAGTCTGAGCGACGGGGGCCCGTGGTCCTCCACATTGGCCACCAGCCC
CCTGGACCAGCAGGACGTGAAGCCGGGACGTGAAGATCTGCAACTGGGAGCAATCATCCATCAC
CGCTCGCCTCACGTAGCCCACCACTCGCCCCACACTAACCATCCGAACGCCTGGGGAGCGAGCC
CGGCTCCAAACTCGTCCATCACGTCCAGCGGCCAACCTCTCAATGTGTACTCGCAGCCAGGCTT
CACGGTGAGTGGTATGCTAGAGCACGGGGGACTCACTCCACCACCAGCTGCTGCCTCCACACAG
AGCCTGCATCCAGTGCTCCGGGAGCCTCCAGACCATGGTGAGCTGGGCTCGCACCACTGCCAGG
ACCACTCGGATGAAGAGACTCCAACCTCTGATGAGTTGGAACAGTTCGCCAAACAATTCAAACA
AAGAAGAATCAAGTTGGGTTTCACGCAAGCCGACGTGGGGCTGGCATTGGGCACACTGTATGGC
AACGTGTTCTCGCAGACTACCATCTGCAGGTTCGAGGCCTTGCAACTGAGCTTCAAGAACATGT
GCAAGCTGAAACCACTGCTAAATAAGTGGCTGGAGGAGGCTGATTCATCCACAGGAAGCCCGAC
CAGCATTGACAAGATCGCCGCTCAGGGCCGTAAACGCAAGAAGCGAACCTCCATTGAGGTGAGT
GTCAAGGGCGTACTGGAAACGCATTTCCTCAAGTGTCCCAAGCCTGCAGCACAGGAGATCTCCT
CGCTGGCAGACAGTCTCCAGTTGGAGAAAGAAGTGGTACGTGTCTGGTTCTGTAATAGAAGACA
AAAAGAAAAAAGAATGACTCCGCCAGGGGATCAGCAGCCACACGAGGTTTATTCGCACACGGTG
AAAACAGATGCGTCCTGCCACGATCTCTGACTGGAGGAAGCAAGGAGGTGGCCCGCTGCACTGG
GAGCAGTGCTGATACAATTCTCTCTTTACCTTCCTTTCAGCATTACATTCTTTATTATTGCTAT
CTCTCTAGCTTGCTAGCTCTTCCTTTCTTTCACAGGGGTTTCTAACTTCTTATGACTTATGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_058948	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42042	(Get FASTA)	NCBI Sequence Viewer
	CAA77855	(Get FASTA)	NCBI Sequence Viewer
	EDM07095	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003724
	ENSRNOP00000003724.4
	ENSRNOP00055039545
	ENSRNOP00060036517
	ENSRNOP00065037781
GenBank Protein	P62516	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058948 ⟸ NM_017252

- UniProtKB:

P62516 (UniProtKB/Swiss-Prot), A6IV85 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATAASNPYSILSSSSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDG
GPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNSSITSSG
QPLNVYSQPGFTVSGMLEHGGLTPPPAAASTQSLHPVLREPPDHGELGSHHCQDHSDEETPTSD
ELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWL
EEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKE
VVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDASCHDL

hide sequence

RefSeq Acc Id:

ENSRNOP00000003724 ⟸ ENSRNOT00000003724

Protein Domains

Homeobox POU-specific

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62516-F1-model_v2	AlphaFold	P62516	1-361	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61947	AgrOrtholog
BioCyc Gene	G2FUF-1848	BioCyc
Ensembl Genes	ENSRNOG00000002784	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055027746	UniProtKB/Swiss-Prot
	ENSRNOG00060025440	UniProtKB/Swiss-Prot
	ENSRNOG00065026685	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000003724	ENTREZGENE
	ENSRNOT00000003724.7	UniProtKB/Swiss-Prot
	ENSRNOT00055048040	UniProtKB/Swiss-Prot
	ENSRNOT00060044014	UniProtKB/Swiss-Prot
	ENSRNOT00065046047	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.260.40	UniProtKB/Swiss-Prot
	Homeodomain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	lambda repressor-like DNA-binding domains	UniProtKB/TrEMBL
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeobox_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lambda_DNA-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TF_POU_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29589	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	29589	ENTREZGENE
PANTHER	POU DOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU DOMAIN, CLASS 3, TRANSCRIPTION FACTOR 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Homeodomain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pou	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pou3f4	PhenoGen
PIRSF	Transcription_factor_POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	POUDOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000002784	RatGTEx
	ENSRNOG00055027746	RatGTEx
	ENSRNOG00060025440	RatGTEx
	ENSRNOG00065026685	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain-like	UniProtKB/TrEMBL
	lambda repressor-like DNA-binding domains	UniProtKB/TrEMBL
	SSF46689	UniProtKB/Swiss-Prot
	SSF47413	UniProtKB/Swiss-Prot
UniProt	A6IV85	ENTREZGENE, UniProtKB/TrEMBL
	P62516	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	P25216	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-24	Pou3f4	POU class 3 homeobox 4	Pou3f4	POU domain, class 3, transcription factor 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Pou3f4	POU domain, class 3, transcription factor 4			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM