Gcm1 (glial cells missing transcription factor 1)

Gene: Gcm1 (glial cells missing transcription factor 1) Rattus norvegicus

Analyze

Symbol:

Gcm1

Name:

glial cells missing transcription factor 1

RGD ID:

61852

Description:

Predicted to enable several functions, including DNA-binding transcription activator activity, RNA polymerase II-specific; histone deacetylase binding activity; and zinc ion binding activity. Predicted to be involved in several processes, including cell differentiation involved in embryonic placenta development; regulation of cell differentiation involved in embryonic placenta development; and transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including astrocyte fate commitment; branching involved in labyrinthine layer morphogenesis; and positive regulation of syncytium formation by plasma membrane fusion. Predicted to be part of transcription regulator complex. Predicted to be active in nucleus. Orthologous to human GCM1 (glial cells missing transcription factor 1); INTERACTS WITH (S)-nicotine; 2,2',4,4'-Tetrabromodiphenyl ether; 3,7-dihydropurine-6-thione.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

chorion-specific transcription factor GCMa; GCM motif protein 1; Gcma; glial cells missing homolog 1; glial cells missing homolog 1 (Drosophila)

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	87,805,993 - 87,819,229 (+)	NCBI		GRCr8
mRatBN7.2	8	78,925,687 - 78,938,924 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	78,925,687 - 78,938,924 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	84,412,841 - 84,426,055 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	82,689,502 - 82,702,716 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	80,512,207 - 80,525,423 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	85,355,766 - 85,369,002 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	85,355,766 - 85,369,002 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	84,920,654 - 84,933,890 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	83,018,975 - 83,032,211 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	83,038,028 - 83,051,265 (+)	NCBI
Celera	8	78,670,476 - 78,683,712 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,7-dihydropurine-6-thione (EXP)

acetaldehyde (ISO)

acetic acid (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

beta-naphthoflavone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bromochloroacetic acid (ISO)

carbon nanotube (ISO)

carmustine (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

chrysene (ISO)

colforsin daropate hydrochloride (ISO)

diisononyl phthalate (ISO)

ethylparaben (ISO)

flavonoids (EXP)

flusilazole (ISO)

folic acid (ISO)

fulvestrant (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

mercaptopurine (EXP)

methapyrilene (ISO)

methylmercury chloride (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO)

nicotine (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

purine-6-thiol (EXP)

sodium arsenite (ISO)

tetraphene (ISO)

trichostatin A (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

astrocyte fate commitment (ISO)

branching involved in labyrinthine layer morphogenesis (ISO)

cell differentiation involved in embryonic placenta development (IBA,ISO)

gliogenesis (IBA)

positive regulation of DNA-templated transcription (ISO)

positive regulation of syncytium formation by plasma membrane fusion (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of cell differentiation involved in embryonic placenta development (ISO)

regulation of DNA-templated transcription (ISO,TAS)

regulation of transcription by RNA polymerase II (IBA)

syncytium formation by plasma membrane fusion (ISO)

transcription by RNA polymerase II (ISO)

Cellular Component

nucleus (IBA,ISO)

transcription regulator complex (ISO)

Molecular Function

DNA binding (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO,TAS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,ISO)

histone deacetylase binding (ISO)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

sequence-specific double-stranded DNA binding (ISO)

zinc ion binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Isolation and characterization of mammalian homologs of the Drosophila gene glial cells missing.	Kim J, etal., Proc Natl Acad Sci U S A 1998 Oct 13;95(21):12364-9.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10888880	PMID:12297286	PMID:14573516	PMID:15385555	PMID:19219068	PMID:21558372	PMID:23610556	PMID:23867755	PMID:27917469

Genomics

Comparative Map Data

Gcm1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	87,805,993 - 87,819,229 (+)	NCBI		GRCr8
mRatBN7.2	8	78,925,687 - 78,938,924 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	78,925,687 - 78,938,924 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	84,412,841 - 84,426,055 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	82,689,502 - 82,702,716 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	80,512,207 - 80,525,423 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	85,355,766 - 85,369,002 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	85,355,766 - 85,369,002 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	84,920,654 - 84,933,890 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	83,018,975 - 83,032,211 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	83,038,028 - 83,051,265 (+)	NCBI
Celera	8	78,670,476 - 78,683,712 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

GCM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	53,126,961 - 53,148,841 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	53,126,961 - 53,148,841 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	52,991,759 - 53,013,639 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	53,099,721 - 53,121,586 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	53,099,720 - 53,121,586	NCBI
Celera	6	54,653,553 - 54,675,420 (-)	NCBI		Celera
Cytogenetic Map	6	p12.1	NCBI
HuRef	6	52,823,388 - 52,845,251 (-)	NCBI		HuRef
CHM1_1	6	52,993,522 - 53,015,402 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	52,966,559 - 52,988,449 (-)	NCBI		T2T-CHM13v2.0

Gcm1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	77,959,240 - 77,972,906 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	77,959,206 - 77,972,906 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	78,051,958 - 78,065,624 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	78,051,924 - 78,065,624 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	77,899,765 - 77,913,431 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	77,837,642 - 77,851,308 (+)	NCBI		MGSCv36	mm8
Celera	9	75,229,708 - 75,242,850 (+)	NCBI		Celera
Cytogenetic Map	9	E1	NCBI
cM Map	9	43.49	NCBI

Gcm1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	2,898,693 - 2,917,168 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955411	2,872,758 - 2,917,154 (+)	NCBI	ChiLan1.0	ChiLan1.0

GCM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	67,597,729 - 67,619,569 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	63,474,401 - 63,496,262 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	52,681,528 - 52,703,367 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	54,319,737 - 54,341,582 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	54,319,744 - 54,341,582 (-)	Ensembl	panpan1.1		panPan2

GCM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	20,623,593 - 20,642,861 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	20,623,717 - 20,640,193 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	20,517,343 - 20,562,563 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	21,120,964 - 21,166,452 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	21,120,940 - 21,140,877 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	20,625,674 - 20,671,144 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	20,730,476 - 20,775,852 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	20,868,003 - 20,913,270 (-)	NCBI		UU_Cfam_GSD_1.0

Gcm1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	56,221,801 - 56,235,619 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936476	7,724,666 - 7,738,401 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GCM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	46,767,498 - 46,791,037 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	46,767,498 - 46,798,317 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	134,509,950 - 134,516,913 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GCM1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	19,421,054 - 19,444,311 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	19,424,896 - 19,443,079 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	52,976,804 - 53,020,227 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gcm1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624850	406,840 - 421,128 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624850	405,001 - 421,208 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gcm1
68 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	45
Count of miRNA genes:	38
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000010583
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	75311777	84531599	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	75311938	82925521	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	nervous system	renal system	reproductive system	respiratory system
High
Medium						7
Low					2	18	2
Below cutoff	3	2	2	2	8	8	6	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC133981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF081557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000010583 ⟹ ENSRNOP00000010583

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	78,925,687 - 78,938,924 (+)	Ensembl
Rnor_6.0 Ensembl	8	85,355,766 - 85,369,002 (+)	Ensembl

RefSeq Acc Id:

NM_017186 ⟹ NP_058882

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	87,805,993 - 87,819,229 (+)	NCBI
mRatBN7.2	8	78,925,687 - 78,938,924 (+)	NCBI
Rnor_6.0	8	85,355,766 - 85,369,002 (+)	NCBI
Rnor_5.0	8	84,920,654 - 84,933,890 (+)	NCBI
RGSC_v3.4	8	83,018,975 - 83,032,211 (+)	RGD
Celera	8	78,670,476 - 78,683,712 (+)	RGD

Sequence:

show sequence

TGAACGAGAAGGAGGGACTCAGGCCTCAGGAGCACTGAAGATGGAAAGGCTTTGAAAAACAAGC
CCTTCAGCTGCTCTCGTGGACAGAGTTCTGAGACTGCGAGCTCTCGAGACATCTCTGACGATTT
GAGAAGAGCCTGTGTTGAGCCGACCTCATCATGGAACTGGACGACTTTGATCCTGAAGACAAAG
AGATACTGAGCTGGGATATTAACGACATGAAGCTGCCTCAGAATGTGAAGAAGACTGACTGGTT
CCAGGAGTGGCCAGACTCCTACGTGAAACACATCTACAGCTCAGACGACAGGAGCGCACAGCGC
CATCTGAGCAGCTGGGCCATGCGCAACACCAACAACCACAACTCCCGGATCCTCAAGAAGTCGT
GCCTGGGGGTAGTGGTGTGCAGCAGGGACTGTTCCACGGAGGAAGGCCGCAAGATTTACCTGAG
ACCCGCCATCTGTGACAAAGCCAGGCAGAAGCAGCAGAGGAAAAGCTGTCCCAACTGCAATGGA
CCCCTGAAACTAATTCCCTGCAGAGGCCACGGCGGCTTCCCGGTCACCAACTTCTGGAGGCATG
ACGGACGCTTCATCTTTTTCCAGTCCAAAGGAGAGCACGATCATCCCAGGCCGGAGACCAAGCT
AGAAGCAGAGGCAAGAAGAGCCATGAAGAAAGTGCACATGGCCTCTGCCTCCAGCTCCTTACGG
ATGAAGGGGAGACCAGAAATGAAGGGTCTCCCAGGTGAAATCCCGAGTCAGGGAAGTTTACCTT
TAACTTGGTCATTCCAGGAAGGGGTCCAACTGCCCAGCGGTTACAGCACACCTTTAATAGCTAA
CGCTCCCCAGCAGAACTCCCTCAATGATTGCCTGTCCTTCCCCAAGAGCTATGACTTGGGGGGA
ACCACTGAGCTAGAAGATCCAACTTCCACCTTAGATCCCACGAAGCTCTATGAGAGATATAAGT
TCTCCAGCAGTAAGGTCTACAGCGCTGAAGACCAGTTCCAGCCTCCTGTCCCCGGGGTGTACGG
AGATTATGATGAAGCACAAACCTGGAATAAAAATGCTGTCTTAGGGAGAAGTCCTACTGACGAC
ACCTACTATCCACCCTATCCTCTGCCTGTGGCCAGCTGGCCCTGTGACTACCTTCCCTCCCAGA
GCTCTTTGGAGCACTCTCCCCAACAGGTTCCACTAGAGCCACCTGCAGCTCAACCCGGCCATCA
TCCCTTGTGGACCAATCCCGGAGGTGAGCCTTACGAAGAGAAAGTTCCTGTGGATTTCAGCAGC
TATGTGCCTTCTGTCACGTACCACTCCCCTCAGCAGGACCCCTTTCTGCTCGCTTACGGCTCTC
ATCCTCAGCAGCAGTACGCGCTGCCTGGTAAGAGCAACAGGTGGGATTTCGATGAAGAGATGGC
GTGCATGGGCTTGGATCACTTCAACAACGAGATGCTCCTAAACCTCTGTTCTTTAAAATAACTC
ATAGCCCGCTTCCTGCTCTCCCCATCAT

hide sequence

Protein Sequences


Protein RefSeqs	NP_058882	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC64783	(Get FASTA)	NCBI Sequence Viewer
	EDL77757	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010583
	ENSRNOP00000010583.1
	ENSRNOP00055008497
	ENSRNOP00060026488
	ENSRNOP00065021842
GenBank Protein	Q9Z288	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058882 ⟸ NM_017186

- UniProtKB:

Q9Z288 (UniProtKB/Swiss-Prot), A6I1H0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MELDDFDPEDKEILSWDINDMKLPQNVKKTDWFQEWPDSYVKHIYSSDDRSAQRHLSSWAMRNT
NNHNSRILKKSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGH
GGFPVTNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARRAMKKVHMASASSSLRMKGRPEMKGL
PGEIPSQGSLPLTWSFQEGVQLPSGYSTPLIANAPQQNSLNDCLSFPKSYDLGGTTELEDPTST
LDPTKLYERYKFSSSKVYSAEDQFQPPVPGVYGDYDEAQTWNKNAVLGRSPTDDTYYPPYPLPV
ASWPCDYLPSQSSLEHSPQQVPLEPPAAQPGHHPLWTNPGGEPYEEKVPVDFSSYVPSVTYHSP
QQDPFLLAYGSHPQQQYALPGKSNRWDFDEEMACMGLDHFNNEMLLNLCSLK

hide sequence

RefSeq Acc Id:

ENSRNOP00000010583 ⟸ ENSRNOT00000010583

Protein Domains

GCM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9Z288-F1-model_v2	AlphaFold	Q9Z288	1-436	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61852	AgrOrtholog
BioCyc Gene	G2FUF-29776	BioCyc
Ensembl Genes	ENSRNOG00000007932	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055006686	UniProtKB/Swiss-Prot
	ENSRNOG00060018836	UniProtKB/Swiss-Prot
	ENSRNOG00065016639	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010583	ENTREZGENE
	ENSRNOT00000010583.3	UniProtKB/Swiss-Prot
	ENSRNOT00055010913	UniProtKB/Swiss-Prot
	ENSRNOT00060032478	UniProtKB/Swiss-Prot
	ENSRNOT00065027721	UniProtKB/Swiss-Prot
Gene3D-CATH	2.20.25.670	UniProtKB/Swiss-Prot
	3.30.70.3530	UniProtKB/Swiss-Prot
	GCM domain, large subdomain	UniProtKB/TrEMBL
	GCM motif	UniProtKB/TrEMBL
InterPro	GCM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GCM_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GCM_large	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GCM_small	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tscrpt_reg_GCM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29394	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	29394	ENTREZGENE
PANTHER	CHORION-SPECIFIC TRANSCRIPTION FACTOR GCMA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GLIAL CELLS MISSING RELATED/GLIDE	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
Pfam	GCM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gcm1	PhenoGen
PROSITE	GCM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007932	RatGTEx
	ENSRNOG00055006686	RatGTEx
	ENSRNOG00060018836	RatGTEx
	ENSRNOG00065016639	RatGTEx
Superfamily-SCOP	GCM domain	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6I1H0	ENTREZGENE, UniProtKB/TrEMBL
	GCM1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-12-04	Gcm1	glial cells missing transcription factor 1	Gcm1	glial cells missing homolog 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-03	Gcm1	glial cells missing homolog 1	Gcm1	glial cells missing homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-04-22	Gcm1	glial cells missing homolog 1 (Drosophila)	Gcma	glial cells missing (Drosophila) homolog a	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED
2002-06-10	Gcma	glial cells missing (Drosophila) homolog a			Name updated	70584	APPROVED
2001-12-06	Gcma	glial cells missing (Drosophila) homolog a			Symbol and Name updated to reflect Human and Mouse nomenclature	69665	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed during embryonic development	61603
gene_process	transforms presumptive neurons into glia	61603

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar