Adra2c (adrenoceptor alpha 2C) - Rat Genome Database

Name: Adra2c
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Adra2c (adrenoceptor alpha 2C) Rattus norvegicus

Analyze

Symbol:

Adra2c

Name:

adrenoceptor alpha 2C

RGD ID:

2058

Description:

Predicted to enable several functions, including alpha-2A adrenergic receptor binding activity; alpha2-adrenergic receptor activity; and protein dimerization activity. Involved in female pregnancy; negative regulation of uterine smooth muscle contraction; and positive regulation of vasoconstriction. Located in axon terminus and neuronal cell body. Is active in glutamatergic synapse and postsynaptic density membrane. Human ortholog(s) of this gene implicated in congestive heart failure. Orthologous to human ADRA2C (adrenoceptor alpha 2C); INTERACTS WITH (D-Ala(2)-mephe(4)-gly-ol(5))enkephalin; 3H-1,2-dithiole-3-thione; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Adrenergic alpha2C- receptor class I; adrenergic receptor, alpha 2c; adrenergic, alpha-2C-, receptor; Adrenergic, alpha2C-, receptor class I; alpha-2 adrenergic receptor subtype C4; alpha-2C adrenergic receptor; alpha-2C adrenoceptor; alpha-2C adrenoreceptor; alpha-2CAR

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADRA2C (adrenoceptor alpha 2C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Adra2c (adrenergic receptor, alpha 2c)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ADRA2C (adrenoceptor alpha 2C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADRA2C (adrenoceptor alpha 2C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADRA2C (adrenoceptor alpha 2C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ADRA2C (adrenoceptor alpha 2C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Adra2c (adrenoceptor alpha 2C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	BTG2 (BTG anti-proliferation factor 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Adra2c (adrenergic receptor, alpha 2c)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ADRA2C (adrenoceptor alpha 2C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	adra2c (adrenoceptor alpha 2C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Octalpha2R	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	octr-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	adra2c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	79,695,514 - 79,697,476 (-)	NCBI		GRCr8
mRatBN7.2	14	75,470,884 - 75,472,846 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	75,471,143 - 75,472,846 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	79,924,216 - 79,926,175 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	81,165,071 - 81,167,030 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	77,610,079 - 77,612,038 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	80,730,307 - 80,732,010 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	80,730,307 - 80,732,010 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	81,422,130 - 81,423,833 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	81,107,907 - 81,109,610 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	81,110,297 - 81,112,001 (-)	NCBI
Celera	14	74,399,360 - 74,401,063 (-)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cardiomegaly (ISO)

congestive heart failure (ISO)

Ellis-Van Creveld syndrome (ISO)

Fibrosis (ISO)

genetic disease (ISO)

Hyperalgesia (IMP)

Neuralgia (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(D-Ala(2)-mephe(4)-gly-ol(5))enkephalin (EXP)

(R)-adrenaline (ISO)

(R)-noradrenaline (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-methoxyidazoxan (ISO)

2-phenylethylamine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (ISO)

arsenite(3-) (ISO)

Bardoxolone methyl (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

bromobenzene (EXP)

C60 fullerene (EXP)

calcium atom (ISO)

calcium(0) (ISO)

chlorpyrifos (EXP)

clofibrate (ISO)

clonidine (EXP,ISO)

clonidine (amino form) (EXP,ISO)

clonidine (imino form) (EXP,ISO)

colforsin daropate hydrochloride (ISO)

copper(II) sulfate (ISO)

dexamethasone (ISO)

dichlorine (EXP)

diethylstilbestrol (ISO)

dopamine (ISO)

elemental selenium (ISO)

ethanol (ISO)

fipronil (ISO)

flavonoids (EXP)

genistein (EXP,ISO)

indometacin (ISO)

lipopolysaccharide (ISO)

methoxychlor (EXP)

metoprolol (ISO)

N,N-diethyl-m-toluamide (ISO)

naphthalene (EXP)

nickel atom (EXP)

Nonylphenol (EXP)

oxcarbazepine (EXP)

oxymetazoline (ISO)

ozone (EXP)

phenylpropanolamine (ISO)

progesterone (ISO)

quercitrin (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

selenium atom (ISO)

sulindac sulfide (ISO)

sunitinib (ISO)

synephrine (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

troglitazone (EXP)

urethane (ISO)

valproic acid (ISO)

vitamin E (ISO)

vorinostat (ISO)

Xylometazoline (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating adrenergic receptor signaling pathway (IBA)

adrenergic receptor signaling pathway (ISO)

female pregnancy (IMP)

G protein-coupled receptor signaling pathway (ISO)

negative regulation of uterine smooth muscle contraction (IMP)

platelet activation (IEA)

positive regulation of MAPK cascade (ISO)

positive regulation of neuron differentiation (ISO)

positive regulation of vasoconstriction (IMP)

Cellular Component

axon (IDA)

axon terminus (IDA)

cytoplasm (ISO)

glutamatergic synapse (EXP,IDA)

neuronal cell body (IDA)

plasma membrane (ISO)

postsynaptic density membrane (EXP,IDA)

postsynaptic membrane (IDA)

Molecular Function

alpha-2A adrenergic receptor binding (ISO)

alpha2-adrenergic receptor activity (IBA,ISO)

epinephrine binding (IBA,ISO)

G protein-coupled receptor activity (ISO)

protein binding (ISO)

protein heterodimerization activity (ISO)

protein homodimerization activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning and expression of a rat brain alpha 2B-adrenergic receptor.	Flordellis CS, etal., Proc Natl Acad Sci U S A 1991 Feb 1;88(3):1019-23.
2.	The roles of alpha2-adrenoceptor subtypes in the control of cervical resistance in the late-pregnant rat.	Gal A, etal., Eur J Pharmacol. 2009 Aug 1;615(1-3):193-200. Epub 2009 May 15.
3.	Different roles of alpha2-adrenoceptor subtypes in non-pregnant and late-pregnant uterine contractility in vitro in the rat.	Gaspar R, etal., Neurochem Int. 2007 Oct;51(5):311-8. Epub 2007 Jul 1.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Postjunctional alpha2C-adrenoceptors mediate vasoconstriction in rat tail artery: influence of precontraction and temperature on vasoreactivity.	Jantschak F, etal., Naunyn Schmiedebergs Arch Pharmacol. 2010 Dec;382(5-6):487-97. Epub 2010 Sep 24.
7.	Ultrastructural evidence for prominent postsynaptic localization of alpha2C-adrenergic receptors in catecholaminergic dendrites in the rat nucleus locus coeruleus.	Lee A, etal., J Comp Neurol. 1998 May 4;394(2):218-29.
8.	Decreased spinal alpha2a- and alpha2c-adrenergic receptor subtype mRNA in a rat model of neuropathic pain.	Leiphart JW, etal., Neurosci Lett. 2003 Sep 25;349(1):5-8.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	Axon terminals possessing the alpha 2c-adrenergic receptor in the rat dorsal horn are predominantly excitatory.	Olave MJ and Maxwell DJ, Brain Res 2003 Mar 7;965(1-2):269-73.
12.	An investigation of neurones that possess the alpha 2C-adrenergic receptor in the rat dorsal horn.	Olave MJ and Maxwell DJ, Neuroscience 2002;115(1):31-40.
13.	Axon terminals possessing alpha2C-adrenergic receptors densely innervate neurons in the rat lateral spinal nucleus which respond to noxious stimulation.	Olave MJ and Maxwell DJ, Neuroscience 2004;126(2):391-403.
14.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
15.	Physiological significance of alpha(2)-adrenergic receptor subtype diversity: one receptor is not enough.	Philipp M, etal., Am J Physiol Regul Integr Comp Physiol. 2002 Aug;283(2):R287-95.
16.	GOA pipeline	RGD automated data pipeline
17.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Activation of spinal alpha-2 adrenoceptors, but not mu-opioid receptors, reduces the intrathecal N-methyl-D-aspartate-induced increase in spinal NR1 subunit phosphorylation and nociceptive behaviors in the rat.	Roh DH, etal., Anesth Analg. 2010 Feb 1;110(2):622-9. Epub 2009 Dec 10.
20.	Synergistic polymorphisms of beta1- and alpha2C-adrenergic receptors and the risk of congestive heart failure.	Small KM, etal., N Engl J Med 2002 Oct 10;347(15):1135-42.
21.	alpha(2a) and alpha(2c) adrenoceptors on spinal neurons controlling penile erection.	Yaici ED, etal., Neuroscience 2002;114(4):945-60.

Additional References at PubMed

PMID:1645350	PMID:1704314	PMID:14712229	PMID:16605244	PMID:17215105	PMID:19000416	PMID:20607388	PMID:20691504	PMID:20854830	PMID:21518261	PMID:21562737	PMID:22892388
PMID:25218984	PMID:25407049

Genomics

Comparative Map Data

Adra2c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	79,695,514 - 79,697,476 (-)	NCBI		GRCr8
mRatBN7.2	14	75,470,884 - 75,472,846 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	75,471,143 - 75,472,846 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	79,924,216 - 79,926,175 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	81,165,071 - 81,167,030 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	77,610,079 - 77,612,038 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	80,730,307 - 80,732,010 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	80,730,307 - 80,732,010 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	81,422,130 - 81,423,833 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	81,107,907 - 81,109,610 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	81,110,297 - 81,112,001 (-)	NCBI
Celera	14	74,399,360 - 74,401,063 (-)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

ADRA2C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	3,766,385 - 3,768,526 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	3,766,348 - 3,768,526 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	3,768,112 - 3,770,253 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	3,738,094 - 3,740,051 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	3,804,398 - 3,807,217	NCBI
Celera	4	3,671,112 - 3,673,097 (+)	NCBI		Celera
Cytogenetic Map	4	p16.3	NCBI
HuRef	4	3,705,412 - 3,707,390 (+)	NCBI		HuRef
CHM1_1	4	3,766,238 - 3,768,183 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	3,765,283 - 3,767,445 (+)	NCBI		T2T-CHM13v2.0

Adra2c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	35,435,910 - 35,439,107 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	35,435,663 - 35,439,107 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	35,278,566 - 35,281,763 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	35,278,319 - 35,281,763 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	35,621,215 - 35,624,412 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	35,595,575 - 35,598,742 (+)	NCBI		MGSCv36	mm8
Celera	5	32,753,998 - 32,757,254 (+)	NCBI		Celera
Cytogenetic Map	5	B2	NCBI
cM Map	5	18.09	NCBI

ADRA2C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	4,099,781 - 4,102,012 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	4,033,469 - 4,035,654 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	3,904,346 - 3,906,577 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	3,894,575 - 3,897,018 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

ADRA2C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	60,608,632 - 60,648,112 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	60,646,132 - 60,647,722 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	63,296,546 - 63,298,547 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	61,121,798 - 61,123,799 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	3	60,615,963 - 60,617,962 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	60,821,563 - 60,823,566 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	61,177,369 - 61,179,380 (-)	NCBI		UU_Cfam_GSD_1.0

ADRA2C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	2,320,226 - 2,321,608 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	2,320,125 - 2,322,162 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	2,048,614 - 2,050,639 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADRA2C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	44,950,928 - 44,953,245 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	44,951,457 - 44,952,827 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666051	1,297,830 - 1,299,978 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adra2c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624755	24,300,347 - 24,301,693 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624755	24,299,985 - 24,301,824 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Adra2c
13 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	115
Count of miRNA genes:	88
Interacting mature miRNAs:	91
Transcripts:	ENSRNOT00000012322
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	37669719	82669719	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	37669719	82669719	Rat
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	37669719	82669719	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	37669719	82669719	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39057237	83368335	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39998251	75582726	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	40793460	98037301	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42262529	95023211	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	50023211	95023211	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	55147478	100147478	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	55624247	100624247	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	55624247	100624247	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	56631369	101631369	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	58184885	103184885	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	68757796	83368335	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	70053989	104886043	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	70053989	104886043	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	73415323	92554092	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	92554092	Rat
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	92554092	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	73415323	92554092	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	95876975	Rat

Markers in Region

D14Mco2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	75,469,752 - 75,469,784 (+)	MAPPER	mRatBN7.2
mRatBN7.2	14	75,469,493 - 75,469,784 (+)	MAPPER	mRatBN7.2
mRatBN7.2	14	75,469,493 - 75,470,354 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	80,728,059 - 80,728,948	NCBI	Rnor6.0
Rnor_6.0	14	80,728,059 - 80,728,347	NCBI	Rnor6.0
Rnor_5.0	14	81,419,882 - 81,420,170	UniSTS	Rnor5.0
Rnor_5.0	14	81,419,882 - 81,420,771	UniSTS	Rnor5.0
RGSC_v3.4	14	81,106,260 - 81,106,548	UniSTS	RGSC3.4
RGSC_v3.4	14	81,106,259 - 81,106,548	RGD	RGSC3.4
RGSC_v3.1	14	81,108,650 - 81,108,939	RGD
Celera	14	74,397,716 - 74,398,002	UniSTS
Cytogenetic Map	14	q21	UniSTS

RH131895

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	75,470,925 - 75,471,132 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	80,730,090 - 80,730,296	NCBI	Rnor6.0
Rnor_5.0	14	81,421,913 - 81,422,119	UniSTS	Rnor5.0
RGSC_v3.4	14	81,107,690 - 81,107,896	UniSTS	RGSC3.4
Celera	14	74,399,143 - 74,399,349	UniSTS
Cytogenetic Map	14	q21	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									20
Low			1		1				40	4	5
Below cutoff	3	12	21	12	11	12	7	8	14	29	27	8	7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	D00819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L19347	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M58316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M62371	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X57659	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000012322 ⟹ ENSRNOP00000012322

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	75,471,143 - 75,472,846 (-)	Ensembl
Rnor_6.0 Ensembl	14	80,730,307 - 80,732,010 (-)	Ensembl

RefSeq Acc Id:

NM_138506 ⟹ NP_612515

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	79,695,514 - 79,697,476 (-)	NCBI
mRatBN7.2	14	75,470,884 - 75,472,846 (-)	NCBI
Rnor_6.0	14	80,730,307 - 80,732,010 (-)	NCBI
Rnor_5.0	14	81,422,130 - 81,423,833 (-)	NCBI
RGSC_v3.4	14	81,107,907 - 81,109,610 (-)	RGD
Celera	14	74,399,360 - 74,401,063 (-)	RGD

Sequence:

show sequence

GATGCAGACGCCGACTCTGGCTGTGGGGCGCCCGAGCTGCGGAGGCTGCGCCCCGGCTCCTGGC
AGGACCGCGTAGCTCTCGGGAGGACCATGGCGTCCCCAGCGCTGGCCGCGGCCCTGGCGGCGGC
GGCGGCTGAGGGCCCCAACGGGAGCGACGCGGGCGAATGGGGTAGCGGCGGGGGTGCCAATGCC
TCGGGGACCGACTGGGCACCACCGCCGGGCCAGTACTCCGCAGGTGCTGTGGCAGGGCTGGCAG
CCGTGGTGGGTTTCCTCATCGTTTTCACCGTGGTGGGCACCGTGCTCGTGGTGATCGCTGTGTT
GACAAGCCGAGCGCTGCGCGCCCCGCAGAACCTCTTCCTGGTGTCTCTGGCCTCAGCTGACATC
CTGGTGGCCACACTGGTCATGCCCTTTTCGCTGGCCAATGAGCTCATGGCCTACTGGTACTTTG
GGCAAGTGTGGTGTGGTGTGTACCTGGCACTGGACGTGCTCTTCTGCACCTCGTCCATCGTGCA
CCTGTGTGCCATTAGCCTGGACCGCTACTGGTCGGTGACGCAAGCGGTAGAGTACAACCTGAAG
CGCACGCCACGCCGTGTCAAGGCCACCATCGTGGCCGTGTGGCTCATCTCGGCTGTCATCTCCT
TCCCGCCTCTCGTCTCTTTCTACCGCCGGCCCGACGGCGCCGCCTACCCGCAGTGCGGCCTCAA
CGATGAGACCTGGTACATCTTGTCCTCCTGCATAGGCTCCTTCTTCGCGCCCTGCCTCATCATG
GGCCTGGTCTATGCGCGCATCTACCGCGTGGCCAAGCTGCGCACGCGTACGCTCACGGAGAAAC
GCGGCCCCGCCGGCCCCGACGGCGCGTCCCCGACCACAGAGAATGGGTTGGGCAAGGCGGCGGG
GGAGAATGGGCATTGCGCGCCCCCGCGCACTGAAGTGGAGCCGGATGAGAGCAGCGCGGCAGAG
AGGCGGAGGCGCCGGGGAGCGCTGCGCAGAGGAGGACGGCGGCGAGAGGGTGCCGAGGGGGACA
CGGGCAGTGCGGACGGACCGGGACCTGGGTTGGCGGCCGAACAGGGTGCTCGGACGGCGTCTCG
GTCTCCAGGCCCCGGAGGGCGCCTGTCGCGGGCCAGCTCGCGCTCCGTCGAGTTCTTCCTGTCG
CGTCGGCGCCGGGCGCGCAGCAGTGTGTGCCGCCGCAAGGTGGCCCAGGCGCGCGAGAAACGCT
TCACCTTCGTGTTGGCGGTGGTCATGGGCGTGTTCGTACTGTGCTGGTTCCCCTTCTTCTTCAG
CTACAGCCTGTATGGCATCTGCCGTGAGGCCTGCCAGCTGCCAGAACCGCTCTTTAAGTTTTTC
TTCTGGATCGGCTACTGCAACAGTTCGCTCAACCCGGTCATCTATACTGTCTTCAATCAGGACT
TCAGGCGCTCTTTCAAGCACATCCTCTTCCGTAGGAGGAGAAGGGGCTTCAGGCAGTGACCCTC
TGGCTGCCTGGACTTGGCCCCACTGACCTCCTGGACAGCTCCGAACTCGGGTACATAGGGGGAC
CAACCAGTGTGGCTTCTCCAGAGTTCCAGGGCGGACTTCAGGGTACAGTGTGGAATGTGGCCAG
CAGGAACTGGGAGAGAGACAACTGGGCCTCTGGGAGTGGGGAGGAGAAAGGGAGACCCTTTGCC
TTCCCATCTCAGCGAGGGGCTGTGGCTAGATCCAGTTCCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_612515	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40634	(Get FASTA)	NCBI Sequence Viewer
	AAA42033	(Get FASTA)	NCBI Sequence Viewer
	BAA00700	(Get FASTA)	NCBI Sequence Viewer
	CAA40861	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012322
	ENSRNOP00000012322.1
	ENSRNOP00055023393
	ENSRNOP00060035335
	ENSRNOP00065046727
GenBank Protein	P22086	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_612515 ⟸ NM_138506

- UniProtKB:

P22086 (UniProtKB/Swiss-Prot), A6IK05 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWAPPPGQYSAGAVAGLAAVVGFLIVF
TVVGTVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFGQVWCGVYL
ALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISAVISFPPLVSFYR
RPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLRTRTLTEKRGPAGPDGA
SPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRRGGRRREGAEGDTGSADGPGP
GLAAEQGARTASRSPGPGGRLSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVM
GVFVLCWFPFFFSYSLYGICREACQLPEPLFKFFFWIGYCNSSLNPVIYTVFNQDFRRSFKHIL
FRRRRRGFRQ

hide sequence

RefSeq Acc Id:

ENSRNOP00000012322 ⟸ ENSRNOT00000012322

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P22086-F1-model_v2	AlphaFold	P22086	1-458	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2058	AgrOrtholog
BioCyc Gene	G2FUF-15316	BioCyc
Ensembl Genes	ENSRNOG00000009299	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055017127	UniProtKB/Swiss-Prot
	ENSRNOG00060024662	UniProtKB/Swiss-Prot
	ENSRNOG00065032982	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012322	ENTREZGENE
	ENSRNOT00000012322.4	UniProtKB/Swiss-Prot
	ENSRNOT00055029058	UniProtKB/Swiss-Prot
	ENSRNOT00060042655	UniProtKB/Swiss-Prot
	ENSRNOT00065056748	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	ADR_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADRA2C_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24175	UniProtKB/Swiss-Prot
NCBI Gene	24175	ENTREZGENE
PANTHER	ADRENERGIC RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ALPHA-2C ADRENERGIC RECEPTOR	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	ADRA2C	RGD
PhenoGen	Adra2c	PhenoGen
PRINTS	ADRENERGICR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADRENRGCA2CR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009299	RatGTEx
	ENSRNOG00055017127	RatGTEx
	ENSRNOG00060024662	RatGTEx
	ENSRNOG00065032982	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6IK05	ENTREZGENE, UniProtKB/TrEMBL
	ADA2C_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-07-13	Adra2c	adrenoceptor alpha 2C	Adra2c	adrenergic, alpha-2C-, receptor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Adra2c	adrenergic, alpha-2C-, receptor	Adra2c	adrenergic receptor, alpha 2c	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-11-06	Adra2c	adrenergic receptor, alpha 2c		Adrenergic, alpha2C-, receptor class I	Name updated	625702	APPROVED
2002-06-10	Adra2c	Adrenergic, alpha2C-, receptor class I			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	protein detected in spinal cord neurons	631768
gene_function	may mediate noradrenaline action	632213
gene_process	may mediate penile erection	631768

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD