Wscd2 (WSC domain containing 2) - Rat Genome Database

Name: Wscd2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Wscd2 (WSC domain containing 2) Rattus norvegicus

Analyze

Symbol:

Wscd2

Name:

WSC domain containing 2

RGD ID:

1589744

Description:

Predicted to enable sulfotransferase activity. Predicted to be located in Golgi membrane. Orthologous to human WSCD2 (WSC domain containing 2); INTERACTS WITH Cuprizon; furan; glyphosate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC360824; sialate:O-sulfotransferase 2; similar to CG9164-PA, isoform A; uncharacterized protein LOC360824; WSC domain containing 2, pseudogene 1; WSC domain-containing protein 2; Wscd2-ps1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WSCD2 (WSC domain containing 2)	RGD	RGD
Mus musculus (house mouse):	Wscd2 (WSC domain containing 2)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Wscd2 (WSC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WSCD2 (WSC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WSCD2 (WSC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wscd2 (WSC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WSCD2 (WSC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WSCD2 (WSC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wscd2 (WSC domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	WSCD2 (WSC domain containing 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Wscd2 (WSC domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wscd2 (WSC domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9164	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	wscd2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	48,707,056 - 48,801,443 (-)	NCBI		GRCr8
mRatBN7.2	12	43,046,547 - 43,141,115 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	43,048,043 - 43,088,591 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	44,214,794 - 44,255,310 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	44,828,390 - 44,868,908 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	43,888,910 - 43,929,426 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	48,814,840 - 48,861,823 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	48,817,320 - 48,857,724 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	50,604,398 - 50,644,835 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	44,092,503 - 44,116,693 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	44,650,412 - 44,691,156 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Marfanoid Mental Retardation Syndrome, Autosomal (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bisphenol A (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chrysene (ISO)

Cuprizon (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

folic acid (ISO)

furan (EXP)

glyphosate (EXP)

GW 4064 (ISO)

lipopolysaccharide (ISO)

methoxychlor (EXP)

ozone (ISO)

phenylmercury acetate (ISO)

pioglitazone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

Golgi membrane (ISO)

Molecular Function

sulfotransferase activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Wscd2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	48,707,056 - 48,801,443 (-)	NCBI		GRCr8
mRatBN7.2	12	43,046,547 - 43,141,115 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	43,048,043 - 43,088,591 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	44,214,794 - 44,255,310 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	44,828,390 - 44,868,908 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	43,888,910 - 43,929,426 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	48,814,840 - 48,861,823 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	48,817,320 - 48,857,724 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	50,604,398 - 50,644,835 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	44,092,503 - 44,116,693 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	12	44,650,412 - 44,691,156 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

WSCD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	108,129,288 - 108,250,537 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	108,129,288 - 108,250,537 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	108,523,065 - 108,644,314 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	107,047,641 - 107,168,444 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	12	108,192,896 - 108,313,742 (+)	NCBI		Celera
Cytogenetic Map	12	q23.3	NCBI
HuRef	12	105,587,869 - 105,709,101 (+)	NCBI		HuRef
CHM1_1	12	108,489,523 - 108,610,374 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	108,097,493 - 108,218,761 (+)	NCBI		T2T-CHM13v2.0

Wscd2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	113,636,976 - 113,727,786 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	113,638,199 - 113,727,786 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	113,489,110 - 113,589,725 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	113,490,333 - 113,589,725 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	113,919,467 - 113,919,962 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv37	5	114,000,238 - 114,039,679 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	113,811,231 - 113,815,392 (+)	NCBI		MGSCv36	mm8
Celera	5	110,602,724 - 110,691,585 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	55.55	NCBI

Wscd2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	9,436,781 - 9,550,020 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955455	9,433,628 - 9,549,862 (+)	NCBI	ChiLan1.0	ChiLan1.0

WSCD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	116,188,504 - 116,310,297 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	116,184,891 - 116,306,695 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	105,699,932 - 105,822,088 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	109,096,956 - 109,218,774 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	109,163,457 - 109,218,774 (+)	Ensembl	panpan1.1		panPan2

WSCD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	18,572,453 - 18,692,433 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	18,573,098 - 18,691,240 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	17,106,103 - 17,225,154 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	18,921,064 - 19,040,414 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	18,921,067 - 19,037,326 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	17,378,314 - 17,434,521 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	18,909,897 - 19,029,246 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	18,930,135 - 19,046,288 (-)	NCBI		UU_Cfam_GSD_1.0

Wscd2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	145,203,653 - 145,288,717 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936769	232,649 - 270,727 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936769	187,183 - 272,241 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WSCD2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	42,489,398 - 42,584,135 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	42,482,923 - 42,584,388 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	45,050,230 - 45,092,764 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WSCD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	103,312,914 - 103,441,294 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	103,382,420 - 103,439,518 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	141,646,697 - 141,771,162 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wscd2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	11,457,951 - 11,513,335 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	11,401,588 - 11,512,924 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wscd2
944 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Markers in Region

RH137309

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	43,074,511 - 43,074,699 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	48,843,788 - 48,843,975	NCBI	Rnor6.0
Rnor_5.0	12	50,630,789 - 50,630,976	UniSTS	Rnor5.0
RGSC_v3.4	12	44,118,972 - 44,119,159	UniSTS	RGSC3.4
Celera	12	44,676,879 - 44,677,066	UniSTS
RH 3.4 Map	12	822.92	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									39
Low	3	28	11		14		1	1	35	21	40	11	1
Below cutoff		14	27	22	5	22	7	10		14	1		7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001271178	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271546	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000080783 ⟹ ENSRNOP00000071851

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	43,048,043 - 43,088,591 (-)	Ensembl
Rnor_6.0 Ensembl	12	48,817,320 - 48,857,724 (-)	Ensembl

RefSeq Acc Id:

NM_001271178 ⟹ NP_001258107

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	48,707,056 - 48,801,319 (-)	NCBI
mRatBN7.2	12	43,048,043 - 43,088,591 (-)	NCBI
Rnor_6.0	12	48,817,320 - 48,857,724 (-)	NCBI
Rnor_5.0	12	50,604,398 - 50,644,835 (-)	NCBI
Celera	12	44,650,412 - 44,691,156 (-)	NCBI

Sequence:

show sequence

GCGCACCAAGCCTTTGCGGTTTCATTCCTGAGGAGTCCCCAGAAGCCACGCCCTCCGCGCCCCT
TCCCAGCCATCCACCCAGCCTGCCCCGAGCCAGTCCGTAATGATCCTGCTATGGCCAAGCTCTG
GTTCAAGTTCCAGCGGTGTTTCCGGTATTTCCGCAGGAAGCCCGTGCGCTTCTTTACACTGCTG
GCTATCTACCTGACCGCCGGGAGCCTTGTCTTCCTGCACTCCGGCTTCGTGGGCCAGCCTTCGG
TGCCCCAGAGCCAGGCCAGCCCCGCAGCGGGGAGCCCGGCGGAAGGAGGAGCCGAGCTGCCTTT
CCTGGGTGACTTGCACCTGGGCAGAGGTTTCCGAGACACCGTGGAGGCCTCCAGCATCGCACGG
AGGTACGGACCCACATTCAAGGGCAAGGACACCAGTGAGAGAGCCAAATTGGGCGACTACGGAG
GAGCCTGGAGCCGAGCCCTCAAGGGGAGGGTTGTTCGGGAGAAGGAGAAGGAAAAGGAGGAGGA
GAGAGCCAAGTACATCGGCTGCTACCTGGACGACACCCAGAGCCGGGCCCTGCGAGGTGTGTCC
TTTTTCGACTACAAAAAGATGACAGTCTTCCGTTGCCAGGACAACTGTGCTGAACGGGGTTACC
TGTACGCTGGGCTGGAGTTCGGCGCTGAGTGCTACTGTGGTCACAAGATCCAGGCGGCCAACGT
GAGTGAAGCGGACTGTGATATGGACTGCAAAGGAGAAAGGGGCAGCGTGTGTGGTGGCATCAAC
CGCCTCTCCGTCTACCGGCTGCAGCTGGCCCAGGAGTCTGCCCGACGGTATGGTAGTGCCGTGT
TCAGAGGCTGCTTCCGGCGACCCAACAACCTTTCCCTGGCCTTGCCCGTGACAGTCGCCATGCC
GAACATGTCTGTGGACAAGTGCGTGGACCTCTGCACAGAAAAGGAGTTCCCCCTGGCAGCCCTC
GCGGGCACCGCCTGCCACTGCGGCTTTCCCACCACACGGTTCCCTCTTCATGACCGGGAGGATG
AGCAACTGTGCGCCCAGAAGTGCAGCGCGGAGGAGTTCGAGAGCTGTGGGACCCCCAGCTACTT
CATCGTGTACCAGACACAGGTCCAAGACAACCGCTGTATGGACAGAAGGTTCCTCCCAGCCAAG
TCGAAGAAGCTCATCGCTCTAGCCAGCTTCCCGGGCGCCGGCAACACGTGGGCTCGCCACCTCA
TCGAGCTGGCTACCGGCTTTTACACTGGCAGCTACTACTTCGATGGCTCTCTGTACAACAAAGG
ATTCAAAGGTGAACGCGACCACTGGCGAAGCGGGCGGACCATCTGCATCAAGACCCACGAGAGC
GGCCAGAAGGAGATCGAGGCCTTCGACTCGGCTATCTTGCTCATCCGCAACCCCTACAAGGCCC
TCATGGCAGAGTTCAACCGCAAATATGGAGGCCACATAGGCTTTGCCGCCCACGCCCACTGGAA
AGGCAAAGAATGGCCCGAGTTTGTGAGGAACTATGCCCCGTGGTGGGCCACGCACACGCTGGAC
TGGCTCAAGTTTGGCAAGACCGTACTGGTGGTGCACTTCGAGGATCTGAAGCAGGACTTGTTTA
CGCAGCTGGGTCGCATGGTCAGCCTGCTGGGCGTGGCGGTCAGGGAGGATCGGCTGCTGTGTGT
GGAGAGCCAGAAGGATGGCAACTTCAAGCGCTCGGGGCTGCGCAAGCTGGAGTATGACCCTTAC
ACAGCCGAGATGCGCAGGACCATCGCCGCCTACATCAGGATGGTGGACACAGCGCTGCGCAGCC
GCAACCTCACTGGGGTGCCTGAGGCCTATGGCCCAAGATGATGGGCAGACAGGGAGGGACCCAG
CACGC

hide sequence

RefSeq Acc Id:

XM_039089613 ⟹ XP_038945541

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	48,707,056 - 48,737,711 (-)	NCBI
mRatBN7.2	12	43,046,547 - 43,077,204 (-)	NCBI

RefSeq Acc Id:

XM_063271546 ⟹ XP_063127616

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	48,707,056 - 48,801,443 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001258107	(Get FASTA)	NCBI Sequence Viewer
	XP_038945541	(Get FASTA)	NCBI Sequence Viewer
	XP_063127616	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM13973	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071851
	ENSRNOP00000071851.2

RefSeq Acc Id:

NP_001258107 ⟸ NM_001271178

- UniProtKB:

A0A0G2K1I1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAKLWFKFQRCFRYFRRKPVRFFTLLAIYLTAGSLVFLHSGFVGQPSVPQSQASPAAGSPAEGG
AELPFLGDLHLGRGFRDTVEASSIARRYGPTFKGKDTSERAKLGDYGGAWSRALKGRVVREKEK
EKEEERAKYIGCYLDDTQSRALRGVSFFDYKKMTVFRCQDNCAERGYLYAGLEFGAECYCGHKI
QAANVSEADCDMDCKGERGSVCGGINRLSVYRLQLAQESARRYGSAVFRGCFRRPNNLSLALPV
TVAMPNMSVDKCVDLCTEKEFPLAALAGTACHCGFPTTRFPLHDREDEQLCAQKCSAEEFESCG
TPSYFIVYQTQVQDNRCMDRRFLPAKSKKLIALASFPGAGNTWARHLIELATGFYTGSYYFDGS
LYNKGFKGERDHWRSGRTICIKTHESGQKEIEAFDSAILLIRNPYKALMAEFNRKYGGHIGFAA
HAHWKGKEWPEFVRNYAPWWATHTLDWLKFGKTVLVVHFEDLKQDLFTQLGRMVSLLGVAVRED
RLLCVESQKDGNFKRSGLRKLEYDPYTAEMRRTIAAYIRMVDTALRSRNLTGVPEAYGPR

hide sequence

RefSeq Acc Id:

ENSRNOP00000071851 ⟸ ENSRNOT00000080783

RefSeq Acc Id:	XP_038945541 ⟸ XM_039089613
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063127616 ⟸ XM_063271546
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K1I1 (UniProtKB/TrEMBL)

Protein Domains

WSC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K1I1-F1-model_v2	AlphaFold	A0A0G2K1I1	1-572	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1589744	AgrOrtholog
BioCyc Gene	G2FUF-18910	BioCyc
Ensembl Genes	ENSRNOG00000053045	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000080783	ENTREZGENE
	ENSRNOT00000080783.2	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
InterPro	P-loop_NTPase	UniProtKB/TrEMBL
	WSC_carb-bd	UniProtKB/TrEMBL
KEGG Report	rno:360824	UniProtKB/TrEMBL
NCBI Gene	360824	ENTREZGENE
PANTHER	WSC DOMAIN-CONTAINING PROTEIN 2	UniProtKB/TrEMBL
	WSCD FAMILY MEMBER CG9164	UniProtKB/TrEMBL
Pfam	WSC	UniProtKB/TrEMBL
PhenoGen	Wscd2	PhenoGen
PROSITE	WSC	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000053045	RatGTEx
SMART	WSC	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A0G2K1I1	ENTREZGENE, UniProtKB/TrEMBL
	A6J234_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-03-07	Wscd2	WSC domain containing 2	Wscd2-ps1	WSC domain containing 2, pseudogene 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-08-25	Wscd2-ps1	WSC domain containing 2, pseudogene 1	LOC360824	similar to CG9164-PA, isoform A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC360824	similar to CG9164-PA, isoform A			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar