Glyatl3 (glycine-N-acyltransferase-like 3)

Gene: Glyatl3 (glycine-N-acyltransferase-like 3) Rattus norvegicus

Analyze

Symbol:

Glyatl3

Name:

glycine-N-acyltransferase-like 3

RGD ID:

1587643

Description:

Predicted to enable glycine N-acyltransferase activity. Predicted to be located in mitochondrion. Orthologous to human GLYATL3 (glycine-N-acyltransferase like 3); INTERACTS WITH acrylamide; bisphenol A; Cuprizon.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

glycine N-acyltransferase-like protein 3; LOC688448; LOC688536; similar to kidney expressed gene 1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GLYATL3 (glycine-N-acyltransferase like 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Glyatl3 (glycine-N-acyltransferase-like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Glyatl3 (glycine-N-acyltransferase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GLYATL3 (glycine-N-acyltransferase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GLYATL3 (glycine-N-acyltransferase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Glyatl3 (glycine-N-acyltransferase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GLYATL3 (glycine-N-acyltransferase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GLYATL3 (glycine-N-acyltransferase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Glyatl3 (glycine-N-acyltransferase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GLYATL3 (glycine-N-acyltransferase like 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Glyatl3 (glycine-N-acyltransferase-like 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-76k16.6	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-106k19.2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-76k16.5	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG12560	Alliance	DIOPT (Hieranoid\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ZK185.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|PhylomeDB)
Caenorhabditis elegans (roundworm):	T10B10.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	27,474,057 - 27,492,281 (+)	NCBI		GRCr8
mRatBN7.2	9	19,977,493 - 19,995,723 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	19,977,302 - 19,995,650 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	28,555,452 - 28,565,981 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	33,630,005 - 33,640,537 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	31,937,028 - 31,947,315 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	23,372,614 - 23,390,764 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	23,379,200 - 23,390,487 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	22,236,745 - 22,248,032 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	16,119,729 - 16,131,491 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	17,661,422 - 17,672,330 (+)	NCBI		Celera
Cytogenetic Map	9	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

Cuprizon (EXP)

mancozeb (ISO)

mono(2-ethylhexyl) phthalate (ISO)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

mitochondrion (IEA)

Molecular Function

glycine N-acyltransferase activity (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:27016726

Genomics

Comparative Map Data

Glyatl3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	27,474,057 - 27,492,281 (+)	NCBI		GRCr8
mRatBN7.2	9	19,977,493 - 19,995,723 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	19,977,302 - 19,995,650 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	28,555,452 - 28,565,981 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	33,630,005 - 33,640,537 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	31,937,028 - 31,947,315 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	23,372,614 - 23,390,764 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	23,379,200 - 23,390,487 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	22,236,745 - 22,248,032 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	16,119,729 - 16,131,491 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	17,661,422 - 17,672,330 (+)	NCBI		Celera
Cytogenetic Map	9	q13	NCBI

GLYATL3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	49,499,923 - 49,528,078 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	49,499,923 - 49,528,078 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	49,467,636 - 49,495,791 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	49,467,671 - 49,495,777 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	6	51,023,868 - 51,051,973 (+)	NCBI		Celera
Cytogenetic Map	6	p12.3	NCBI
HuRef	6	49,197,157 - 49,225,147 (+)	NCBI		HuRef
CHM1_1	6	49,470,698 - 49,498,820 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	49,342,084 - 49,370,250 (+)	NCBI		T2T-CHM13v2.0

Glyatl3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	41,214,599 - 41,229,469 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	41,215,509 - 41,225,241 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	40,904,727 - 40,923,048 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	40,904,618 - 40,914,350 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	41,041,690 - 41,051,299 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	40,368,225 - 40,376,239 (-)	NCBI		MGSCv36	mm8
Celera	17	44,314,932 - 44,324,945 (-)	NCBI		Celera
Cytogenetic Map	17	B2	NCBI
cM Map	17	19.55	NCBI

Glyatl3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955410	33,444,100 - 33,462,285 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955410	33,444,100 - 33,462,285 (-)	NCBI	ChiLan1.0	ChiLan1.0

GLYATL3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	63,989,981 - 64,011,474 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	59,854,701 - 59,876,197 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	49,075,808 - 49,097,303 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	50,337,934 - 50,359,318 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	50,337,934 - 50,359,318 (+)	Ensembl	panpan1.1		panPan2

GLYATL3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	17,359,085 - 17,375,833 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	17,362,736 - 17,375,694 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	17,259,077 - 17,275,637 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	17,855,371 - 17,871,923 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	17,858,986 - 17,870,755 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	17,375,110 - 17,391,850 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	17,480,383 - 17,497,143 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	17,610,009 - 17,626,571 (+)	NCBI		UU_Cfam_GSD_1.0

Glyatl3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	52,776,950 - 52,788,712 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	11,172,032 - 11,183,099 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	11,172,032 - 11,183,099 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GLYATL3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	43,639,946 - 43,659,566 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	43,641,443 - 43,659,754 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	50,130,074 - 50,144,643 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GLYATL3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	22,871,047 - 22,894,071 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	22,872,486 - 22,892,476 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	49,485,043 - 49,505,679 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Glyatl3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	1,796,386 - 1,813,262 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624783	1,796,648 - 1,813,268 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Glyatl3
102 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	32
Count of miRNA genes:	32
Interacting mature miRNAs:	32
Transcripts:	ENSRNOT00000074110
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70226	Eae4	Experimental allergic encephalomyelitis QTL 4			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	9	1	25661317	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	1	37999212	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	1	37999212	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	1	37999212	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	40594091	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	1	43718459	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	1	43718459	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5109826	42921101	Rat
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5109826	50109826	Rat
11353947	Bp392	Blood pressure QTL 392			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	7283252	52283252	Rat
61450	Ciaa3	CIA Autoantibody QTL 3	6.5		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	9	7954720	22071169	Rat
9589133	Insul26	Insulin level QTL 26	17.96	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	9	8952560	53952560	Rat
7411609	Foco16	Food consumption QTL 16	25.6	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	8952560	53952560	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	13533770	42791750	Rat
724543	Cm20	Cardiac mass QTL 20	3.9		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	16961398	40594091	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	2		5	4	1	4			12	6	18
Below cutoff		27	25	19	13	19	2	2	39	15	18	2	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001145062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017596642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017596643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000074110 ⟹ ENSRNOP00000066244

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	19,977,302 - 19,995,650 (+)	Ensembl
Rnor_6.0 Ensembl	9	23,379,200 - 23,390,487 (+)	Ensembl

RefSeq Acc Id:

NM_001145062 ⟹ NP_001138534

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	27,474,057 - 27,492,281 (+)	NCBI
mRatBN7.2	9	19,977,493 - 19,995,723 (+)	NCBI
Rnor_6.0	9	23,379,200 - 23,390,487 (+)	NCBI
Rnor_5.0	9	22,236,745 - 22,248,032 (+)	NCBI
RGSC_v3.4	9	16,119,729 - 16,131,491 (+)	RGD
Celera	9	17,661,422 - 17,672,330 (+)	RGD

Sequence:

show sequence

ATGTTGGTGCTCAACTGCTCCACCAAATTACTCTTACTGGAGAACATGCTGAAGAGTCACTTTC
CTGAATCACTCAAGGTGTATGGAGCAGTGATGAACATAAATCGTGGAAATCCATTTCAAAAGGA
AGTGGTATTGGATTCATGGCCAGACTTCAAAGCCATCATCACCCGGCGACAGAGAGAGGCTGTG
ACAGATAACCTTGACCATTACACTAATGCGTATGCTGTGTTCTACAAAGATGTCAGAGCTTACC
AACAGCTATTGGAAGAACATGATGTTATTAACTGGGACCAAATTTTTCAAATACAAGGGTTGCA
AAGTGAATTATATACCGCTTCCAAAGCCATTGCCAGCGCAAAGCTGTTAGACTTGGAAATAAAG
TTGGCTTCCTTCAAGGCTGTCCACTTTTCTCCTGTTTCATCTGAGCCAGACCACAGTTTCCTAA
CTGGGTCAACCCCGAGACTGACCTACCTGAGTGTCACAGATGCTGATCTTCTCAACCGAACTTG
GTCACGAGGAGGCAACCAGCAGTGCCTTCGGTACTTGGCCAAACTCATCGCCTGCTTTCCCAGC
GTGTGCGTGCGTGATGAGAAGGGAAACCCAGTGTCCTGGGGTATCACAGATCAGTTTGCCACTA
TGTGTCATGGTTACACCCTGCCTGACCATCGCAGGAAAGGTTACAGCCGACTGGTGGCCCTCAC
TCTGGCCAGGAAGTTGCAAAGCCGGGGATTTCCCTCCCAAGGAAACGTCCTTGATGACAACATG
GCCTCTATAAACCTGCTGAAGAGTGTCCATGCTGAGTTCTTGCCTTGTCGTTTCCACAGGCTTA
TTCTAACCCCTGCAGCTTTCTCTAGACAAGCTCACCATTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001138534	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066244
	ENSRNOP00000066244.1

RefSeq Acc Id:

NP_001138534 ⟸ NM_001145062

- UniProtKB:

D3ZHY4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLVLNCSTKLLLLENMLKSHFPESLKVYGAVMNINRGNPFQKEVVLDSWPDFKAIITRRQREAV
TDNLDHYTNAYAVFYKDVRAYQQLLEEHDVINWDQIFQIQGLQSELYTASKAIASAKLLDLEIK
LASFKAVHFSPVSSEPDHSFLTGSTPRLTYLSVTDADLLNRTWSRGGNQQCLRYLAKLIACFPS
VCVRDEKGNPVSWGITDQFATMCHGYTLPDHRRKGYSRLVALTLARKLQSRGFPSQGNVLDDNM
ASINLLKSVHAEFLPCRFHRLILTPAAFSRQAHH

hide sequence

RefSeq Acc Id:

ENSRNOP00000066244 ⟸ ENSRNOT00000074110

Protein Domains

Glycine N-acyltransferase C-terminal Glycine N-acyltransferase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZHY4-F1-model_v2	AlphaFold	D3ZHY4	1-290	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1587643	AgrOrtholog
BioCyc Gene	G2FUF-28084	BioCyc
Ensembl Genes	ENSRNOG00000050990	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000074110	ENTREZGENE
	ENSRNOT00000074110.2	UniProtKB/TrEMBL
Gene3D-CATH	3.40.630.30	UniProtKB/TrEMBL
InterPro	Acyl_CoA_acyltransferase	UniProtKB/TrEMBL
	Glycine_N-acyltransferase	UniProtKB/TrEMBL
	Glycine_N-acyltransferase_C	UniProtKB/TrEMBL
	Glycine_N-acyltransferase_N	UniProtKB/TrEMBL
KEGG Report	rno:688536	UniProtKB/TrEMBL
NCBI Gene	688536	ENTREZGENE
PANTHER	GLYCINE N-ACYLTRANSFERASE-LIKE PROTEIN 3	UniProtKB/TrEMBL
	PTHR15298	UniProtKB/TrEMBL
Pfam	Gly_acyl_tr_C	UniProtKB/TrEMBL
	Gly_acyl_tr_N	UniProtKB/TrEMBL
PhenoGen	Glyatl3	PhenoGen
RatGTEx	ENSRNOG00000050990	RatGTEx
Superfamily-SCOP	Acyl_CoA_acyltransferase	UniProtKB/TrEMBL
UniProt	D3ZHY4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-29	Glyatl3	glycine-N-acyltransferase-like 3	LOC688448	similar to kidney expressed gene 1	Data merged from RGD:1588840	737654	PROVISIONAL
2010-04-23	Glyatl3	glycine-N-acyltransferase-like 3	LOC688536	similar to kidney expressed gene 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC688448	similar to kidney expressed gene 1	LOC684248	similar to kidney expressed gene 1	Data merged from RGD:1592699	1643240	APPROVED
2006-11-20	LOC684248	similar to kidney expressed gene 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC688448	similar to kidney expressed gene 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC688536	similar to kidney expressed gene 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar