Tor2a (torsin family 2, member A)

Gene: Tor2a (torsin family 2, member A) Rattus norvegicus

Analyze

Symbol:

Tor2a

Name:

torsin family 2, member A

RGD ID:

1359111

Description:

Predicted to enable hormone activity and identical protein binding activity. Predicted to be involved in several processes, including positive regulation of cAMP-mediated signaling; positive regulation of calcium ion transmembrane transport; and vasopressin secretion. Predicted to be located in extracellular region. Predicted to be active in endoplasmic reticulum lumen and nuclear envelope. Orthologous to human TOR2A (torsin family 2 member A); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC93778; prosalusin; torsin family 2 member A; torsin-2A

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TOR2A (torsin family 2 member A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Tor2a (torsin family 2, member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tor2a (torsin family 2 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TOR2A (torsin family 2 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TOR2A (torsin family 2 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tor2a (torsin family 2 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TOR2A (torsin family 2 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TOR2A (torsin family 2 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tor2a (torsin family 2 member A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TOR2A (torsin family 2 member A)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tor2a (torsin family 2, member A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tor2a (torsin family 2, member A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ooc-5	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Torsin	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tor-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tor-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tor2a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

NCBI Annotation Information:

Annotation category: suggests misassembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	36,446,260 - 36,450,339 (+)	NCBI		GRCr8
mRatBN7.2	3	16,048,591 - 16,053,198 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	16,048,549 - 16,052,634 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	19,116,791 - 19,120,857 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	27,701,796 - 27,705,862 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	25,953,643 - 25,957,709 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	11,794,731 - 11,800,261 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	11,795,629 - 11,799,693 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	17,132,371 - 17,136,665 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	11,733,950 - 11,738,016 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	11,630,321 - 11,634,386 (+)	NCBI
Celera	3	10,788,141 - 10,792,207 (+)	NCBI		Celera
Cytogenetic Map	3	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital disorder of glycosylation Iu (ISO)

developmental and epileptic encephalopathy (ISO)

developmental and epileptic encephalopathy 31A (ISO)

early infantile epileptic encephalopathy (ISO)

genetic disease (ISO)

primary coenzyme Q10 deficiency 7 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cyclosporin A (ISO)

ethanol (ISO)

inulin (ISO)

methapyrilene (ISO)

methotrexate (ISO)

naphthalene (ISO)

paracetamol (ISO)

pentachlorophenol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

quercetin (ISO)

Soman (EXP)

sunitinib (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

trichloroethene (EXP)

urethane (ISO)

valproic acid (ISO)

vanadyl sulfate (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell-cell signaling (ISO)

chaperone cofactor-dependent protein refolding (IEA)

positive regulation of calcium ion transmembrane transport (ISO)

positive regulation of cAMP-mediated signaling (ISO)

positive regulation of gene expression (ISO)

signal transduction (IEA)

vasopressin secretion (ISO)

Cellular Component

endoplasmic reticulum lumen (IBA,IEA,ISO)

extracellular region (ISO)

nuclear envelope (IBA,IEA)

Molecular Function

ATP binding (IEA)

ATP hydrolysis activity (IEA)

hormone activity (IEA,ISO)

identical protein binding (IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Salusins: newly identified bioactive peptides with hemodynamic and mitogenic activities.	Shichiri M, etal., Nat Med 2003 Sep;9(9):1166-72. Epub 2003 Aug 10.
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:18047553	PMID:18344632	PMID:20015956	PMID:23400761	PMID:23865521	PMID:26952533	PMID:28230187	PMID:30552345	PMID:33300078	PMID:37183727

Genomics

Comparative Map Data

Tor2a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	36,446,260 - 36,450,339 (+)	NCBI		GRCr8
mRatBN7.2	3	16,048,591 - 16,053,198 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	16,048,549 - 16,052,634 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	19,116,791 - 19,120,857 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	27,701,796 - 27,705,862 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	25,953,643 - 25,957,709 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	11,794,731 - 11,800,261 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	11,795,629 - 11,799,693 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	17,132,371 - 17,136,665 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	11,733,950 - 11,738,016 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	11,630,321 - 11,634,386 (+)	NCBI
Celera	3	10,788,141 - 10,792,207 (+)	NCBI		Celera
Cytogenetic Map	3	p11	NCBI

TOR2A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	127,731,524 - 127,735,294 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	127,731,524 - 127,735,313 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	130,493,803 - 130,497,573 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	129,533,624 - 129,537,425 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	127,573,357 - 127,577,111	NCBI
Celera	9	101,144,673 - 101,148,474 (-)	NCBI		Celera
Cytogenetic Map	9	q34.11	NCBI
HuRef	9	100,110,338 - 100,114,163 (-)	NCBI		HuRef
CHM1_1	9	130,644,952 - 130,648,777 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	139,938,968 - 139,942,738 (-)	NCBI		T2T-CHM13v2.0

Tor2a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	32,647,289 - 32,652,256 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	32,647,246 - 32,652,256 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	32,757,234 - 32,762,250 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	32,757,234 - 32,762,244 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	32,612,791 - 32,617,764 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	32,579,280 - 32,584,253 (+)	NCBI		MGSCv36	mm8
Celera	2	32,464,012 - 32,469,100 (+)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	22.09	NCBI

Tor2a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	922,901 - 926,624 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	922,901 - 926,624 (+)	NCBI	ChiLan1.0	ChiLan1.0

TOR2A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	11,619,313 - 11,623,306 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	11,621,660 - 11,625,653 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	98,851,255 - 98,855,086 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	127,523,547 - 127,527,452 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	127,523,547 - 127,527,403 (-)	Ensembl	panpan1.1		panPan2

TOR2A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	55,658,006 - 55,662,181 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	55,658,192 - 55,662,047 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	54,851,506 - 54,855,465 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	56,579,502 - 56,583,704 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	56,579,686 - 56,585,382 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	55,339,751 - 55,343,947 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	55,654,459 - 55,658,654 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	55,745,704 - 55,749,899 (+)	NCBI		UU_Cfam_GSD_1.0

Tor2a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	195,636,568 - 195,640,448 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936487	15,404,065 - 15,408,997 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936487	15,405,089 - 15,408,971 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TOR2A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	268,233,110 - 268,237,458 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	268,233,103 - 268,237,478 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	302,125,770 - 302,128,299 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TOR2A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	10,397,539 - 10,401,355 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	10,397,613 - 10,400,839 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666079	5,819,722 - 5,823,582 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tor2a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	7,802,300 - 7,806,239 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	7,802,202 - 7,806,235 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tor2a
11 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	396
Count of miRNA genes:	199
Interacting mature miRNAs:	227
Transcripts:	ENSRNOT00000030694, ENSRNOT00000067500
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	diastolic blood pressure (CMO:0000005)	3	1	33278763	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	8658162	27494778	Rat
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	8658162	27494778	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	3	10778704	50302886	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	10778823	30356773	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	0.0000000293	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	33	55	41	19	41	1	2	74	35	41	11	1
Low		10	2				7	9					7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001007744	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006233981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010064655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC142126	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000030694 ⟹ ENSRNOP00000030747

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	16,048,549 - 16,052,634 (+)	Ensembl
Rnor_6.0 Ensembl	3	11,795,629 - 11,799,693 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000067500 ⟹ ENSRNOP00000061197

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	16,048,549 - 16,052,011 (+)	Ensembl
Rnor_6.0 Ensembl	3	11,795,679 - 11,799,074 (+)	Ensembl

RefSeq Acc Id:

NM_001007744 ⟹ NP_001007745

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	36,446,298 - 36,450,339 (+)	NCBI
mRatBN7.2	3	16,048,591 - 16,052,632 (+)	NCBI
Rnor_6.0	3	11,795,629 - 11,799,695 (+)	NCBI
Rnor_5.0	3	17,132,371 - 17,136,665 (+)	NCBI
RGSC_v3.4	3	11,733,950 - 11,738,016 (+)	RGD
Celera	3	10,788,141 - 10,792,207 (+)	RGD

Sequence:

show sequence

CACAGGTTCTGGCAGTGGGCCGCCTCTGACTGAAATAGGGCCTCAACCGGATGGCGGTGGCTAG
GCACGGCTGCCCGCCCTGGGGCTCGATCCTCGGGCTGCTCGTGCTGGCCTTGGCTGCCGCCGCC
GCCTGGGACGTGTCTTTTCTGCGATGCAGTTTAGGGTCCTTCTGCGAATGTGACTTCTGGCCCG
ACTTGCCTGGTCTGGAATGTGACCTGGCTCGACACCTAGCTGGCCAGCATTTGGCCAAGGCCCT
GGTGGTGAAGTCATTGAAGGCCTTTGTACAGGACCCAGCCCCCAGCAAGCCATTGGTCCTTTCC
CTGCACGGCTGGACAGGCACTGGGAAGTCCTATGTGAGCTCCCTGCTGGCGCAGTATCTCTTCC
GGGGTGGCCTTCGCAGCCCTCATGTCCATCACTTCTCTCCTATCATCCACTTCCCACATCCCAG
CCACACTGAGCAGTACAAGAATGAGCTCAAGAGCTGGGTCCAGGGGAACCTCACTGCCTGTGGC
CGGTCTCTTTTCCTCTTCGATGAGATGGACAAGCTGCCCCCTGGCCTGATGGAAGTCCTGAAGC
CCTTCCTGGGCCCTTCTTGGGTTGTGTATGGGACCAACTATCGCAAAGCCATTTTCATCTTTAT
CAGCAATACTGGAGGTGAGCAGATCAACCAGGTGGCCCTGGAGGCATGGCGCAGCCGTAGGGAC
AGGGAAGAAATCAGCCTACAGGAGGTGGAGCCAGCAGTGTCCCAAGCTGTGTTGGACAACCCTC
ACCATGGCTTCTGGCGGTCTGGCATCATGGAGGAGCAGCTGCTGGATGCTGTGGTCCCCTTCCT
CCCCCTCCAGCGGCATCATGTGCGCCACTGTGTGCTCAATGAGCTGGCTCAGCTGGGTTTGGAG
CCCCGAGAGGAGGTGGTTCAGGCTGTGCTGGACAGTACCACCTACTTCCCTGAGGAGGAGCAGC
TCTTCTCCTCCAATGGCTGCAAGACAGTGGCATCCCGAATCACATTTTTCCTCTGAGAACCCCG
GGGGCATCATTGCCTCCTCTGCCTAGACAGATCAAACAGACGCCTGGGCGTCTCCTGGAAGAAT
TCTTCCCTAAGCTGGCTGGCAAGTGGGACCCAGAGCACAGAGTTACGATGAAGAAAGGAGTTGG
CAGGCCAAGGAAGAAAGGTCTAGAAGCATCTTTGCTGGGAAATTCCTGGGCACCCCAGAACCTC
ACAGCCTCGCCATTGCTCTGCGGTCTGAGCCTTCTCAATGTGAACGGCAACTCAGGGACAAAGT
GGCTACTCCAGCTGGGGGCTTTTACTGGCACGCCTTGTCTGGTCCCTTCTCCAGATCTCAGCCT
ATGGCTGGACCTGGCAATCCAGCTAGGCCAGGCAAGCATCTCAGTTTTACCAAATGAAAGGACT
CAAGCTGCCACCTGGGCCTGGCTTTCAAAGTTTTTAATTTTGTATGAGAAGAGAGCAGAGATAA
TAAACTTAGCCATGGTATTGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063284071 ⟹ XP_063140141

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	36,446,260 - 36,449,718 (+)	NCBI

RefSeq Acc Id:

XR_010064655

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	36,446,265 - 36,449,313 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001007745	(Get FASTA)	NCBI Sequence Viewer
	XP_063140141	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78943	(Get FASTA)	NCBI Sequence Viewer
	EDL93211	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000030747
	ENSRNOP00000030747.4
	ENSRNOP00000061197.2
	ENSRNOP00055007796
	ENSRNOP00055007799
	ENSRNOP00060047421
	ENSRNOP00060047424
	ENSRNOP00065035828
	ENSRNOP00065035879
GenBank Protein	Q6AYR4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001007745 ⟸ NM_001007744
- Peptide Label:	precursor
- UniProtKB:	Q6AYR4 (UniProtKB/Swiss-Prot), A6JU85 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAVARHGCPPWGSILGLLVLALAAAAAWDVSFLRCSLGSFCECDFWPDLPGLECDLARHLAGQH LAKALVVKSLKAFVQDPAPSKPLVLSLHGWTGTGKSYVSSLLAQYLFRGGLRSPHVHHFSPIIH FPHPSHTEQYKNELKSWVQGNLTACGRSLFLFDEMDKLPPGLMEVLKPFLGPSWVVYGTNYRKA IFIFISNTGGEQINQVALEAWRSRRDREEISLQEVEPAVSQAVLDNPHHGFWRSGIMEEQLLDA VVPFLPLQRHHVRHCVLNELAQLGLEPREEVVQAVLDSTTYFPEEEQLFSSNGCKTVASRITFF L hide sequence

RefSeq Acc Id:

ENSRNOP00000061197 ⟸ ENSRNOT00000067500

RefSeq Acc Id:

ENSRNOP00000030747 ⟸ ENSRNOT00000030694

RefSeq Acc Id:	XP_063140141 ⟸ XM_063284071
- Peptide Label:	isoform X1

Protein Domains

Torsin-1A C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYR4-F1-model_v2	AlphaFold	Q6AYR4	1-321	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691994

Promoter ID:

EPDNEW_R2518

Type:

multiple initiation site

Name:

Tor2a_1

Description:

torsin family 2, member A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	11,795,670 - 11,795,730	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359111	AgrOrtholog
BioCyc Gene	G2FUF-50121	BioCyc
Ensembl Genes	ENSRNOG00000022514	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00055006202	UniProtKB/Swiss-Prot
	ENSRNOG00060033100	UniProtKB/Swiss-Prot
	ENSRNOG00065025304	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000030694	ENTREZGENE
	ENSRNOT00000030694.6	UniProtKB/TrEMBL
	ENSRNOT00000067500.3	UniProtKB/TrEMBL
	ENSRNOT00055010072	UniProtKB/Swiss-Prot
	ENSRNOT00055010075	UniProtKB/Swiss-Prot
	ENSRNOT00060057405	UniProtKB/Swiss-Prot
	ENSRNOT00060057408	UniProtKB/Swiss-Prot
	ENSRNOT00065043649	UniProtKB/Swiss-Prot
	ENSRNOT00065043716	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7109352	IMAGE-MGC_LOAD
InterPro	ClpA/B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TOR1A_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Torsin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Torsin_1/2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:362112	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93778	IMAGE-MGC_LOAD
NCBI Gene	362112	ENTREZGENE
PANTHER	PTHR10760	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TORSIN-2A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	TOR1A_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Torsin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tor2a	PhenoGen
PIRSF	Torsin_2A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	CLPPROTEASEA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000022514	RatGTEx
	ENSRNOG00055006202	RatGTEx
	ENSRNOG00060033100	RatGTEx
	ENSRNOG00065025304	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2QGF4_RAT	UniProtKB/TrEMBL
	A0A8L2QTI7_RAT	UniProtKB/TrEMBL
	A6JU85	ENTREZGENE, UniProtKB/TrEMBL
	Q6AYR4	ENTREZGENE, UniProtKB/Swiss-Prot
	TOR2X_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Tor2a	torsin family 2, member A			Symbol and Name status set to approved	1299863	APPROVED
2005-07-29	Tor2a	torsin family 2, member A			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar