Or6f1 (olfactory receptor family 6 subfamily F member 1)

Gene: Or6f1 (olfactory receptor family 6 subfamily F member 1) Rattus norvegicus

Analyze

Symbol:

Or6f1

Name:

olfactory receptor family 6 subfamily F member 1

RGD ID:

1334399

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in plasma membrane. Orthologous to human OR6F1 (olfactory receptor family 6 subfamily F member 1); INTERACTS WITH bisphenol A; cadmium dichloride; furan.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

LOC100909966; olfactory receptor 13; olfactory receptor 6F1-like; olfactory receptor gene Olr13; olfactory receptor Olr13; Olr13

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	149,301,451 - 149,302,377 (-)	NCBI		GRCr8
mRatBN7.2	1	139,888,779 - 139,889,705 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	139,887,387 - 139,902,727 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	147,805,894 - 147,806,820 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	154,976,532 - 154,977,458 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	147,850,448 - 147,851,374 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	149,786,382 - 149,787,308 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	149,786,382 - 149,787,308 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	1	149,602,346 - 149,603,272 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	155,904,497 - 155,905,423 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	142,363,442 - 142,364,368 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	142,441,847 - 142,442,774 (-)	NCBI
Celera	1	138,242,934 - 138,243,860 (-)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cryopyrin-Associated Periodic Syndromes (ISO)

developmental and epileptic encephalopathy 54 (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

Neurodevelopmental Disorders (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium dichloride (EXP)

CGP 52608 (ISO)

doxorubicin (ISO)

folic acid (ISO)

furan (EXP)

PCB138 (EXP)

tributylstannane (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

Cellular Component

plasma membrane (IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IBA,IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Or6f1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	149,301,451 - 149,302,377 (-)	NCBI		GRCr8
mRatBN7.2	1	139,888,779 - 139,889,705 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	139,887,387 - 139,902,727 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	147,805,894 - 147,806,820 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	154,976,532 - 154,977,458 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	147,850,448 - 147,851,374 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	149,786,382 - 149,787,308 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	149,786,382 - 149,787,308 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	1	149,602,346 - 149,603,272 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	155,904,497 - 155,905,423 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	142,363,442 - 142,364,368 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	142,441,847 - 142,442,774 (-)	NCBI
Celera	1	138,242,934 - 138,243,860 (-)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

OR6F1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	247,711,436 - 247,716,646 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	247,711,436 - 247,716,646 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	247,874,738 - 247,879,948 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	245,941,754 - 245,942,680 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	244,201,171 - 244,202,098	NCBI
Celera	1	221,167,885 - 221,168,811 (-)	NCBI		Celera
Cytogenetic Map	1	q44	NCBI
HuRef	1	218,263,474 - 218,264,400 (-)	NCBI		HuRef
CHM1_1	1	249,147,433 - 249,148,359 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	247,142,262 - 247,147,472 (-)	NCBI		T2T-CHM13v2.0

Or6f1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	85,970,232 - 85,971,158 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	85,967,426 - 85,974,838 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	86,321,024 - 86,321,950 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	86,318,218 - 86,325,630 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	93,469,534 - 93,470,460 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	86,196,785 - 86,197,711 (-)	NCBI		MGSCv36	mm8
Celera	7	83,703,516 - 83,704,442 (-)	NCBI		Celera
Cytogenetic Map	7	D3	NCBI
cM Map	7	48.51	NCBI

LOC100982295
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	1,347,697 - 1,352,898 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	1,625,374 - 1,626,300 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	223,339,289 - 223,340,215 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	228,790,721 - 228,791,769 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	228,790,801 - 228,791,727 (-)	Ensembl	panpan1.1		panPan2

OR6F1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	1,184,208 - 1,185,134 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	1,184,208 - 1,185,134 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	822,489 - 823,415 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	834,484 - 904,644 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	903,718 - 904,644 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	1,113,176 - 1,114,102 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	874,935 - 875,861 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	794,372 - 864,529 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101966291
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	6,007,342 - 6,008,387 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936486	19,553,021 - 19,553,956 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100513138
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	56,347,655 - 56,348,578 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	57,110,777 - 57,111,862 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103230943
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	84,718,125 - 84,719,454 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	84,718,254 - 84,719,177 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	87,145,245 - 87,150,398 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Or6f1
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	38
Count of miRNA genes:	38
Interacting mature miRNAs:	38
Transcripts:	ENSRNOT00000045582
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
61346	Rf2	Renal disease susceptibility QTL 2	3.7		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	99267916	144267916	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	99267916	144267916	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
2303591	Gluco41	Glucose level QTL 41	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	102168504	147168504	Rat
61370	Mcs3	Mammary carcinoma susceptibility QTL 3	2.15		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	102268556	147268556	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	102813953	151162766	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	103111621	148111621	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	103111621	148111621	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	106047847	151047847	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	121767634	166767634	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121833674	166833674	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
631570	Bp94	Blood pressure QTL 94		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123479780	142990467	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	131763437	159756369	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	136745990	163747690	Rat
71118	Thym1	Thymus enlargement QTL 1	10.17	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
724550	Thym3	Thymus enlargement QTL 3	7.82	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	136830018	181830018	Rat

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000045582 ⟹ ENSRNOP00000039235

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	139,887,571 - 139,894,131 (-)	Ensembl
Rnor_6.0 Ensembl	1	149,602,346 - 149,603,272 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000088514 ⟹ ENSRNOP00000070376

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	139,887,387 - 139,902,727 (-)	Ensembl
Rnor_6.0 Ensembl	1	149,786,382 - 149,787,308 (-)	Ensembl

RefSeq Acc Id:

NM_001000116 ⟹ NP_001000116

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	149,301,451 - 149,302,377 (-)	NCBI
mRatBN7.2	1	139,888,779 - 139,889,705 (-)	NCBI
Rnor_6.0	1	149,786,382 - 149,787,308 (-)	NCBI
Rnor_5.0	1	155,904,497 - 155,905,423 (-)	NCBI
RGSC_v3.4	1	142,363,442 - 142,364,368 (-)	RGD
Celera	1	138,242,934 - 138,243,860 (-)	RGD

Sequence:

show sequence

ATGATCACAGAGAATGGGACTCTATCCCAAGGCTTCCTTCTGTTAGGCTTTCCTGGATCTCAGG
TCCTCCAAACTTCTCTTTTTCTCTTTTTTCTGGTGATGTACCTCCTCACCATTGGAGGTAATGT
GGCAATCTTGCTATTGGTCAGTACTTCCCATCAGTTACAGACCCCTATGTATTTCTTTCTGAGC
AATCTGTCATTCTTGGAGATCTGGTACACCACAGCTGCAGTCCCTAAAGCTCTGGCCATTCTGG
TGGGGAGGAGCCAGACCATATCATTTTCAGGTTGCCTTTTGCAGATGTACTTGGTTTTCTCTTT
AGGTTGCACAGAATACTTTCTCTTGGCAGCCATGGCTTATGACCGCTACCTTGCCATCTGTTTT
CCTCTACATTACCAGGTTATCATGAACAGCCTGCTCTCAGCACAGCTGGCTCTTTGCTCCTGGA
TTTGTGGTTTCCTGGCCATTTCTGTGCCGGCAGCCCTTATCAGCACCTTGTCCTTCTGTGGCAC
CCATTCCATCAATCATTTCTTCTGTGACATTGCACCCTGGATTGCCCTGGCCTGTACCAGTACA
CAAGGAGTGGAGACAGTGGCTTTTGTGATTGCTTTTGTGGTTATCCTGAGTTCCTGTCTCATTA
CTCTGATCTCTTATGCCTACATCATCAGAACCATCCTGAGGATCCCCTCAACCAGTGGCCGCAG
AAAAGCTTTCTCCACCTGTTCCTCCCACCTCACTGTGGTACTCATCTGGTATGGGTCTACAATT
TTCCTCCATGTTCGAACATCTATCAAAGATGATTTGCAACTGACTAAAGCTGTTCATGTCCTCA
ATACAGTGGTGACTCCAGCTCTAAATCCCTTCATTTATACCCTTCGTAACAAAGAGGTCAGAGA
AATTCTGGAGAAGAAATGGAAGAGAATGTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000116	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM18602	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000039235.1
	ENSRNOP00000070376
	ENSRNOP00000070376.1

RefSeq Acc Id:

NP_001000116 ⟸ NM_001000116

- UniProtKB:

D3ZQU0 (UniProtKB/TrEMBL), A6I5X8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MITENGTLSQGFLLLGFPGSQVLQTSLFLFFLVMYLLTIGGNVAILLLVSTSHQLQTPMYFFLS
NLSFLEIWYTTAAVPKALAILVGRSQTISFSGCLLQMYLVFSLGCTEYFLLAAMAYDRYLAICF
PLHYQVIMNSLLSAQLALCSWICGFLAISVPAALISTLSFCGTHSINHFFCDIAPWIALACTST
QGVETVAFVIAFVVILSSCLITLISYAYIIRTILRIPSTSGRRKAFSTCSSHLTVVLIWYGSTI
FLHVRTSIKDDLQLTKAVHVLNTVVTPALNPFIYTLRNKEVREILEKKWKRM

hide sequence

RefSeq Acc Id:

ENSRNOP00000070376 ⟸ ENSRNOT00000088514

RefSeq Acc Id:

ENSRNOP00000039235 ⟸ ENSRNOT00000045582

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZQU0-F1-model_v2	AlphaFold	D3ZQU0	1-308	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1334399	AgrOrtholog
BioCyc Gene	G2FUF-58627	BioCyc
Ensembl Genes	ENSRNOG00000032371	Ensembl
	ENSRNOG00000052361	Ensembl
	ENSRNOG00000066619	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000045582.2	UniProtKB/TrEMBL
	ENSRNOT00000088514	ENTREZGENE
	ENSRNOT00000088514.2	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
	Olfact_rcpt_6C-like	UniProtKB/TrEMBL
KEGG Report	rno:293075	UniProtKB/TrEMBL
NCBI Gene	293075	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
	OLFACTORY RECEPTOR 6F1	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or6f1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000032371	RatGTEx
	ENSRNOG00000052361	RatGTEx
	ENSRNOG00000066619	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6I5X8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZQU0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or6f1	olfactory receptor family 6 subfamily F member 1	Olr13	olfactory receptor 13	Symbol and Name Changed	1299863	APPROVED
2021-03-09	Olr13	olfactory receptor 13	LOC100909966	olfactory receptor 6F1-like	Data merged from RGD:6500576	737654	PROVISIONAL
2012-07-05	LOC100909966	olfactory receptor 6F1-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-04-30	Olr13	olfactory receptor 13	Olr13_predicted	olfactory receptor 13 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr13_predicted	olfactory receptor 13 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype