Or2h1 (olfactory receptor family 2 subfamily H member 1)

Gene: Or2h1 (olfactory receptor family 2 subfamily H member 1) Rattus norvegicus

Analyze

Symbol:

Or2h1

Name:

olfactory receptor family 2 subfamily H member 1

RGD ID:

1333311

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of smell. Predicted to be active in plasma membrane. Orthologous to human OR2H1 (olfactory receptor family 2 subfamily H member 1); INTERACTS WITH bis(2-ethylhexyl) phthalate; bisphenol A; genistein.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

MOR256-20; olfactory receptor 1749; olfactory receptor 2; olfactory receptor gene Olr1749; Olr1749; Or2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OR2H1 (olfactory receptor family 2 subfamily H member 1)	HGNC	EggNOG, HomoloGene, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Or2h1 (olfactory receptor family 2 subfamily H member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100971312 (olfactory receptor 2H1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OLF42-1 (olfactory receptor-like protein 42-1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	OR2H2 (olfactory receptor family 2 subfamily H member 2)	HGNC	Ensembl, Panther
Alliance orthologs ³
Homo sapiens (human):	OR2H1 (olfactory receptor family 2 subfamily H member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or2h1 (olfactory receptor family 2 subfamily H member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-26	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-31	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-32	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-28	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-27	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-37	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-33	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-36	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-38	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-35	Alliance	DIOPT (InParanoid\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	1,451,227 - 1,452,165 (+)	NCBI		GRCr8
mRatBN7.2	20	1,445,980 - 1,446,918 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	1,444,837 - 1,449,341 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	1,499,827 - 1,500,765 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	1,503,314 - 1,504,252 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	1,444,839 - 1,445,777 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	1,936,438 - 1,937,376 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	1,936,438 - 1,937,376 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	3,977,729 - 3,978,667 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	1,535,909 - 1,536,847 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	1,535,908 - 1,536,847 (+)	NCBI
Celera	20	2,155,542 - 2,156,480 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

megacolon (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP)

crocidolite asbestos (ISO)

genistein (EXP)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IBA,IEA)

G protein-coupled receptor signaling pathway (IEA)

Cellular Component

plasma membrane (IBA)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IBA,IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	The genomic sequence and comparative analysis of the rat major histocompatibility complex.	Hurt P, etal., Genome Res 2004 Apr;14(4):631-9.
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Or2h1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	1,451,227 - 1,452,165 (+)	NCBI		GRCr8
mRatBN7.2	20	1,445,980 - 1,446,918 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	1,444,837 - 1,449,341 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	1,499,827 - 1,500,765 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	1,503,314 - 1,504,252 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	1,444,839 - 1,445,777 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	1,936,438 - 1,937,376 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	1,936,438 - 1,937,376 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	3,977,729 - 3,978,667 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	1,535,909 - 1,536,847 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	1,535,908 - 1,536,847 (+)	NCBI
Celera	20	2,155,542 - 2,156,480 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

OR2H1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	29,457,155 - 29,464,328 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	29,457,155 - 29,464,328 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	29,424,932 - 29,432,105 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	29,534,209 - 29,540,078 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	29,534,208 - 29,540,076	NCBI
Celera	6	31,032,274 - 31,038,143 (+)	NCBI		Celera
Cytogenetic Map	6	p22.1	NCBI
HuRef	6	29,233,388 - 29,239,257 (+)	NCBI		HuRef
CHM1_1	6	29,428,350 - 29,434,218 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	29,331,813 - 29,338,986 (+)	NCBI		T2T-CHM13v2.0

Or2h1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	37,403,022 - 37,443,877 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	37,401,510 - 37,409,170 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	37,092,845 - 37,132,991 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	37,090,618 - 37,098,278 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	37,229,879 - 37,230,817 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	36,700,987 - 36,701,925 (-)	NCBI		MGSCv36	mm8
Celera	17	40,515,901 - 40,516,839 (-)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	19.16	NCBI

LOC100971312
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	44,084,120 - 44,089,989 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	40,047,431 - 40,053,301 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	29,266,783 - 29,274,665 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	29,926,391 - 29,933,552 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	29,930,999 - 29,931,949 (+)	Ensembl	panpan1.1		panPan2

OLF42-1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	22,527,596 - 22,541,748 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	22,527,596 - 22,528,534 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	25,246,547 - 25,247,485 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants

Variants in Or2h1
10 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	14
Count of miRNA genes:	14
Interacting mature miRNAs:	14
Transcripts:	ENSRNOT00000073981
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724519	Bp144	Blood pressure QTL 144		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	20	1	3624629	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	endocrine system	hemolymphoid system	reproductive system	respiratory system
High
Medium
Low
Below cutoff	1	1	1	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001001429	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BX883052	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000073981 ⟹ ENSRNOP00000065506

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	1,936,438 - 1,937,376 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102624 ⟹ ENSRNOP00000091182

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	1,444,837 - 1,449,341 (+)	Ensembl

RefSeq Acc Id:

NM_001001429 ⟹ NP_001001429

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	1,451,227 - 1,452,165 (+)	NCBI
mRatBN7.2	20	1,445,980 - 1,446,918 (+)	NCBI
Rnor_6.0	20	1,936,438 - 1,937,376 (+)	NCBI
Rnor_5.0	20	3,977,729 - 3,978,667 (+)	NCBI
RGSC_v3.4	20	1,535,909 - 1,536,847 (+)	RGD
Celera	20	2,155,542 - 2,156,480 (+)	RGD

Sequence:

show sequence

ATGGTCAACCAGAGCTCCCCCACTGGCTTCCTCCTGCTGGGCTTCTCTGAACACCCACACCTGG
AAAAGATTCTCTTCGTGGTTGTCTTGTGTTCCTACCTCCTCACCCTCCTAGGAAACACTCTCAT
CCTCCTGCTGTCCACACTCGACCCCAGGCTCCACTCTCCGATGTACTTCTTCCTCTCCAACCTC
TCCTTCTTGGACCTCTGCTTCACCACAACCTGTGTCCCCCAGATGCTACTCAACCTCTGGGGCC
CCACAAAAACCATCAGCTTCCTGGGATGCTCTGTTCAGCTCTTCATCTTCCTGTCCTTGGGAAC
CACCGAATGCATCCTCCTAACAGTAATGGCCTTTGACCGCTATGTGGCTGTCTGCCAACCCCTC
CACTATACCACCATCATCCACCCCCGCCTGTGCTGGAAGCTAGCAGCTGTGGCCTGGATAATGG
GGCTGATTCAATCCATAGTCCAGACACCTCCCACTCTCCGCCTGCCCTTCTGTCCTCATAGGCA
GATAGATGATTTTCTTTGTGAAGTCCCATCTCTAATTCAACTGTCCTGTGGAGACACCACTTTT
AATGAGATTCAGTTGGCTGTGTCCAGTGTCATTCTTGTGGTTGTGCCTCTGAGCCTCATCCTTG
TCTCTTACGGTGCCATTGCCAGGGCAGTGCTGAGGATAAACTCCACTGAAGCATGGAAAAAGGC
TTTTGGGACTTGCTCCTCCCACCTCATCGTGGTCACCCTCTTCTACAGCTCAGTAATCGCTGTC
TATCTGCAACCCAAAAATCCTTATGCCCAGGAGAGGGGCAAGTTCTTTGGTCTCTTCTATGCAG
TGGGCACTCCCACACTGAACCCTCTCATTTATACCCTGAGGAACAAGGAAGTAAAGAGGGCATT
CTGGAGACTTTGGGGGAAGGATGGGGAATCCAAAAATACCTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001001429	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAE84071	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000091182
	ENSRNOP00000091182.1

RefSeq Acc Id:

NP_001001429 ⟸ NM_001001429

- UniProtKB:

Q6MFX6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVNQSSPTGFLLLGFSEHPHLEKILFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFFLSNL
SFLDLCFTTTCVPQMLLNLWGPTKTISFLGCSVQLFIFLSLGTTECILLTVMAFDRYVAVCQPL
HYTTIIHPRLCWKLAAVAWIMGLIQSIVQTPPTLRLPFCPHRQIDDFLCEVPSLIQLSCGDTTF
NEIQLAVSSVILVVVPLSLILVSYGAIARAVLRINSTEAWKKAFGTCSSHLIVVTLFYSSVIAV
YLQPKNPYAQERGKFFGLFYAVGTPTLNPLIYTLRNKEVKRAFWRLWGKDGESKNT

hide sequence

RefSeq Acc Id:

ENSRNOP00000065506 ⟸ ENSRNOT00000073981

RefSeq Acc Id:

ENSRNOP00000091182 ⟸ ENSRNOT00000102624

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6MFX6-F1-model_v2	AlphaFold	Q6MFX6	1-312	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1333311	AgrOrtholog
BioCyc Gene	G2FUF-4990	BioCyc
Ensembl Genes	ENSRNOG00000048828	Ensembl
	ENSRNOG00000065272	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000102624	ENTREZGENE
	ENSRNOT00000102624.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:294203	UniProtKB/TrEMBL
NCBI Gene	294203	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or2h1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000048828	RatGTEx
	ENSRNOG00000065272	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	Q6MFX6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or2h1	olfactory receptor family 2 subfamily H member 1	Olr1749	olfactory receptor 1749	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1749	olfactory receptor 1749	Olr1749_predicted	olfactory receptor 1749 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1749_predicted	olfactory receptor 1749 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype