Ccl24 (C-C motif chemokine ligand 24)

Gene: Ccl24 (C-C motif chemokine ligand 24) Rattus norvegicus

Analyze

Symbol:

Ccl24

Name:

C-C motif chemokine ligand 24

RGD ID:

1310245

Description:

Predicted to enable CCR3 chemokine receptor binding activity and chemokine activity. Predicted to be involved in several processes, including cellular response to cytokine stimulus; leukocyte chemotaxis; and positive regulation of ERK1 and ERK2 cascade. Predicted to act upstream of or within chemotaxis and positive regulation of eosinophil migration. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in asthma and rhinitis. Orthologous to human CCL24 (C-C motif chemokine ligand 24); PARTICIPATES IN chemokine mediated signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C-C motif chemokine 24; chemokine (C-C motif) ligand 24; eosinophil chemotactic protein 2; eotaxin-2; eotaxin-2-like protein; LOC288593

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	26,737,423 - 26,741,420 (+)	NCBI		GRCr8
mRatBN7.2	12	21,100,835 - 21,104,832 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,100,835 - 21,104,893 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,242,781 - 22,246,614 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	22,855,125 - 22,858,958 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	21,921,589 - 21,925,422 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,131,529 - 24,152,626 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,148,567 - 24,152,625 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	26,128,835 - 26,149,929 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	22,255,293 - 22,259,290 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	22,252,921 - 22,256,286 (+)	NCBI
Celera	12	22,863,236 - 22,867,233 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

allergic disease (ISO)

asthma (ISO)

atopic dermatitis (ISO)

Chromosome 7q11.23 Deletion Syndrome, Distal, 1.2-MB (ISO)

chronic fatigue syndrome (ISO)

drug allergy (ISO)

Eosinophilia (ISO)

genetic disease (ISO)

Nasal Polyps (ISO)

pleomorphic xanthoastrocytoma (ISO)

pneumonia (ISO)

rhinitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

1-nitropyrene (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

barium sulfate (EXP)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

Brevianamide A (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

ceric oxide (EXP)

chlorpyrifos (ISO)

choline (ISO)

chromium(6+) (ISO)

cobalt atom (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diisononyl phthalate (ISO)

dioxygen (EXP)

disodium selenite (ISO)

genistein (ISO)

graphene oxide (ISO)

iron(2+) sulfate (anhydrous) (ISO)

metformin (ISO)

methimazole (EXP)

N-acetyl-L-cysteine (ISO)

nickel atom (ISO)

ozone (ISO)

paraquat (EXP)

pirinixic acid (ISO)

propiconazole (EXP)

Ptaquiloside (ISO)

rac-lactic acid (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP,ISO)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

TMC-120A (ISO)

trichloroethene (EXP)

triphenyl phosphate (EXP)

valproic acid (ISO)

zinc atom (ISO)

zinc dichloride (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antimicrobial humoral immune response mediated by antimicrobial peptide (IBA)

biological_process (ND)

cellular response to interleukin-1 (IBA)

cellular response to tumor necrosis factor (IBA)

cellular response to type II interferon (IBA)

chemokine-mediated signaling pathway (IBA)

chemotaxis (ISO)

cytoskeleton organization (ISO)

eosinophil chemotaxis (IBA,ISO)

G protein-coupled receptor signaling pathway (IBA)

inflammatory response (IBA)

lymphocyte chemotaxis (IBA)

monocyte chemotaxis (IBA)

neutrophil chemotaxis (IBA)

positive regulation of actin filament polymerization (ISO)

positive regulation of angiogenesis (ISO)

positive regulation of cell migration (IBA,ISO)

positive regulation of endothelial cell proliferation (ISO)

positive regulation of eosinophil migration (ISO)

positive regulation of ERK1 and ERK2 cascade (IBA)

positive regulation of inflammatory response (ISO)

regulation of cell shape (ISO)

signal transduction (ISO)

Cellular Component

extracellular space (IBA)

Molecular Function

CCR chemokine receptor binding (IBA)

CCR3 chemokine receptor binding (ISO)

chemokine activity (IBA,ISO)

cytokine activity (ISO)

protein binding (ISO)

receptor ligand activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Analysis of the polymorphisms in eotaxin gene family and their association with asthma, IgE, and eosinophil.	Chae SC, etal., Biochem Biophys Res Commun. 2004 Jul 16;320(1):131-7.
2.	The suggestive association of eotaxin-2 and eotaxin-3 gene polymorphisms in Korean population with allergic rhinitis.	Chae SC, etal., Immunogenetics. 2005 Jan;56(10):760-4. Epub 2004 Dec 4.
3.	A central regulatory role for eosinophils and the eotaxin/CCR3 axis in chronic experimental allergic airway inflammation.	Fulkerson PC, etal., Proc Natl Acad Sci U S A. 2006 Oct 31;103(44):16418-23. Epub 2006 Oct 23.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Glucocorticosteroids inhibit mRNA expression for eotaxin, eotaxin-2, and monocyte-chemotactic protein-4 in human airway inflammation with eosinophilia.	Jahnsen FL, etal., J Immunol. 1999 Aug 1;163(3):1545-51.
7.	Reductions in circulating levels of IL-16, IL-7 and VEGF-A in myalgic encephalomyelitis/chronic fatigue syndrome.	Landi A, etal., Cytokine. 2016 Feb;78:27-36. doi: 10.1016/j.cyto.2015.11.018. Epub 2015 Nov 28.
8.	Genetic interactions model among Eotaxin gene polymorphisms in asthma.	Lee JH, etal., J Hum Genet. 2008;53(10):867-75. Epub 2008 Aug 20.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Comparison of plasma eotaxin family level in aspirin-induced and aspirin-tolerant asthma patients.	Min JW, etal., Chest. 2005 Nov;128(5):3127-32.
11.	Coexpression of IL-5 and eotaxin-2 in mice creates an eosinophil-dependent model of respiratory inflammation with characteristics of severe asthma.	Ochkur SI, etal., J Immunol. 2007 Jun 15;178(12):7879-89.
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	Role of the chemokines RANTES, monocyte chemotactic proteins-3 and -4, and eotaxins-1 and -2 in childhood asthma.	Rojas-Ramos E, etal., Eur Respir J. 2003 Aug;22(2):310-6.
17.	Association of Eotaxin gene family with asthma and serum total IgE.	Shin HD, etal., Hum Mol Genet. 2003 Jun 1;12(11):1279-85.
18.	Eotaxin-1, -2, and -3 immunoreactivity and protein concentration in the nasal polyps of eosinophilic chronic rhinosinusitis patients.	Yao T, etal., Laryngoscope. 2009 Jun;119(6):1053-9.
19.	Complementary DNA microarray analysis of chemokines and their receptors in allergic rhinitis.	Zhang RX, etal., J Investig Allergol Clin Immunol. 2007;17(5):329-36.

Additional References at PubMed

PMID:10072545	PMID:11067944	PMID:11425309	PMID:12477932	PMID:15647285	PMID:19525930	PMID:19841166

Genomics

Comparative Map Data

Ccl24
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	26,737,423 - 26,741,420 (+)	NCBI		GRCr8
mRatBN7.2	12	21,100,835 - 21,104,832 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,100,835 - 21,104,893 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,242,781 - 22,246,614 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	22,855,125 - 22,858,958 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	21,921,589 - 21,925,422 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,131,529 - 24,152,626 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,148,567 - 24,152,625 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	26,128,835 - 26,149,929 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	22,255,293 - 22,259,290 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	22,252,921 - 22,256,286 (+)	NCBI
Celera	12	22,863,236 - 22,867,233 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

CCL24
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	75,810,825 - 75,823,372 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	75,810,825 - 75,823,356 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	75,440,143 - 75,452,690 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	75,279,050 - 75,280,969 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	75,085,764 - 75,087,684	NCBI
Celera	7	70,308,880 - 70,310,799 (-)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	70,527,210 - 70,529,129 (-)	NCBI		HuRef
CHM1_1	7	75,371,135 - 75,373,054 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	77,097,889 - 77,110,477 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	74,774,178 - 74,776,097 (-)	NCBI

Ccl24
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	135,598,789 - 135,601,977 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	135,598,791 - 135,601,903 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	135,569,935 - 135,573,123 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	135,569,937 - 135,573,049 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	136,045,807 - 136,048,913 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	135,855,239 - 135,857,652 (-)	NCBI		MGSCv36	mm8
Celera	5	132,581,470 - 132,584,576 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	75.28	NCBI

Ccl24
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	14,583,610 - 14,585,169 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955456	14,582,812 - 14,588,574 (-)	NCBI	ChiLan1.0	ChiLan1.0

CCL24
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	94,139,812 - 94,145,048 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	142,404,562 - 142,409,686 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	68,206,688 - 68,210,343 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	82,263,310 - 82,265,480 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	82,263,310 - 82,265,480 (-)	Ensembl	panpan1.1		panPan2

CCL24
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	7,166,165 - 7,179,606 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	7,166,479 - 7,180,051 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	8,864,028 - 8,865,941 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	6,986,790 - 7,000,238 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	6,987,104 - 7,000,516 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	6,957,433 - 6,959,341 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	6,920,823 - 6,922,728 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	7,084,112 - 7,086,021 (-)	NCBI		UU_Cfam_GSD_1.0

Ccl24
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	131,632,998 - 131,635,886 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	2,400,768 - 2,403,217 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	2,400,743 - 2,403,558 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCL24
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	3	10,347,397 - 10,361,500 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CCL24
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	10,067,482 - 10,069,992 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	10,066,664 - 10,069,695 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	6,366,836 - 6,369,294 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccl24
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	14,640,292 - 14,643,020 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	14,640,486 - 14,652,414 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ccl24
80 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	134
Count of miRNA genes:	110
Interacting mature miRNAs:	120
Transcripts:	ENSRNOT00000045157
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	11073825	24234895	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	19610870	24139202	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
631521	Pia12	Pristane induced arthritis QTL 12	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	20259417	23672083	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2		2		5						3	5
Low	1	35	53	39	14	39	8	11	70	31	31	6	8
Below cutoff		8	2	2		2			4	2	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598297	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC091503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF472507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000045157 ⟹ ENSRNOP00000056109

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	21,100,835 - 21,104,826 (+)	Ensembl
Rnor_6.0 Ensembl	12	24,148,629 - 24,152,620 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000077378 ⟹ ENSRNOP00000070658

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	21,100,835 - 21,104,893 (+)	Ensembl
Rnor_6.0 Ensembl	12	24,148,567 - 24,152,625 (+)	Ensembl

RefSeq Acc Id:

NM_001013045 ⟹ NP_001013063

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	26,737,423 - 26,741,420 (+)	NCBI
mRatBN7.2	12	21,100,835 - 21,104,832 (+)	NCBI
Rnor_6.0	12	24,148,629 - 24,152,626 (+)	NCBI
Rnor_5.0	12	26,128,835 - 26,149,929 (+)	NCBI
RGSC_v3.4	12	22,255,293 - 22,259,290 (+)	RGD
Celera	12	22,863,236 - 22,867,233 (+)	RGD

Sequence:

show sequence

CTTTCTTGCACCCCAGCTTTGAACCCTGAGCTGTACCTGACCTCCAGGACATGGCAGGCTCCAC
CACCATCATTGCTAGCCTTCTACTCCTGGTAGCCTGCACGTGCTGCATCTGCCCCACAGGCTCT
GTGACCATCCCCTCATCTTGCTGCGTGACCTTTATTTCCAAGAAGATTCCAGTAAACCGAGTGA
TTAGCTACCAGTTGGCCAATGGCAGCATCTGTCCCAAGGCAGGGGTCATCTTCATCACTAAAAA
GGGCCATAAGATCTGTACGGATCCCAAGTTGCCATGGGTTCAGAAGCACATAAAGAACCTGGAT
GCCAAGAGAAACCAGCCTTCTGAAGGTGCCAAGGCCCTGGGTCCCAAGTTTGTCATCCAGAAAC
TCCGAGGCAATAGCACCAAGGTTTAGTCACCTCTCCTCTGTCCCTGAACTTGGACATAGGTATT
GACGCTTTACCAGGCTGCCTTGGCCTTGCCACACCAGCTGGGATGAGTCCTGAGTTCGTTTCCC
CTTTCTCAGCATTTCTTTTAGAAAGTGTTTATTCTGTGGGAACCGGAGGGAACTCCAAGCGTGC
CAGTGTTCTGGTGTTTCCTGTGCTGAGTGAGAAGGTTTCAAAAGAATGACATCTGTCCTCCTGT
GTGCTCTTGTGTGTCTCAAAGGCTTCATCAGAGCCTAGGTGCATAAGACCCGAGTACCTGCAGC
TGTGCCTGGCATGCAGCTGGCTTCGATGGGATTCTTGTCTTGGGGTGGGGCCTGAGGGCTGTTT
GTCTGTCCACCTCTGGGTGAAGATCTGTCGGTAGTAACTTCCGAGAGTGTTGGTGGGTATTCTA
GGCTGGTCCCTCCTCCAGTCCTTGGAGCAAATAAAAACTCGGCTGAAATGGAGGATTTCAACGG
CAGCATTTTCAAACCCTTCAGCCTTCGTAAAGCCGGGATGCAGCTCAGTTGGTGAGGTGATTGC
CTAACGCACACAGGACATTGGCTTTCAGTCACAGCACTGCAAAAACTAGGCATGATGGTGCAAT
CCTAGCACTCAGGAGGGACAGGCAGGAAGAGCAGGGTTCAGAAGGCAGAGGCAGGAGGATCTCT
GTGAATTCAATGCCACCCTGGACTACATAGAGAGACCTCCTCTCAAACGTCCGTCTCTAAGAAG
CAGTTCAAGGCTACATAGCCACATAGAAAATTTGAGGTGGGGGTTGGGGATTTAGCTCAGTGGT
AGAGCGCTTGCCTAGGAAGCACAAGGCCCTGGGTTCAGTCCCCAGCTCCGGAAAAAAAGAACCA
AAAAAAAAAAAAAAAAGAAGAAGAAGAAAATTTGAGGTCAGCCTGACCTAGTGTCACTCTCTTC
CTTGCTGCTTCCCCAGAGCCATGTCTGCCCGTGTGCTGTCGTGCTCCTGCCTTGACGACAATGG
ACTGAACCTCTGAACTGTAATCCAGCCCCAATTAAATGTTTTCCTTTATAAGAAAAAAAAAAAA
AAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013063	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87576	(Get FASTA)	NCBI Sequence Viewer
	AAM74022	(Get FASTA)	NCBI Sequence Viewer
	EDM13365	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000056109
	ENSRNOP00000056109.2
	ENSRNOP00000070658.2

RefSeq Acc Id:	NP_001013063 ⟸ NM_001013045
- Peptide Label:	precursor
- UniProtKB:	Q5PPP2 (UniProtKB/TrEMBL), F6Q1T6 (UniProtKB/TrEMBL), Q8K477 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGSTTIIASLLLLVACTCCICPTGSVTIPSSCCVTFISKKIPVNRVISYQLANGSICPKAGVI FITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV hide sequence

RefSeq Acc Id:

ENSRNOP00000056109 ⟸ ENSRNOT00000045157

RefSeq Acc Id:

ENSRNOP00000070658 ⟸ ENSRNOT00000077378

Protein Domains

Chemokine interleukin-8-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5PPP2-F1-model_v2	AlphaFold	Q5PPP2	1-119	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698558

Promoter ID:

EPDNEW_R9075

Type:

single initiation site

Name:

Ccl24_1

Description:

C-C motif chemokine ligand 24

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	24,148,594 - 24,148,654	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310245	AgrOrtholog
BioCyc Gene	G2FUF-19626	BioCyc
Ensembl Genes	ENSRNOG00000031162	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000045157	ENTREZGENE
	ENSRNOT00000045157.4	UniProtKB/TrEMBL
	ENSRNOT00000077378.2	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.40	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7307568	IMAGE-MGC_LOAD
InterPro	Chemokine_b/g/d	UniProtKB/TrEMBL
	Chemokine_IL8	UniProtKB/TrEMBL
	Interleukin_8-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:288593	UniProtKB/TrEMBL
MGC_CLONE	MGC:105554	IMAGE-MGC_LOAD
NCBI Gene	288593	ENTREZGENE
PANTHER	C-C MOTIF CHEMOKINE 24	UniProtKB/TrEMBL
	PTHR12015	UniProtKB/TrEMBL
Pfam	IL8	UniProtKB/TrEMBL
PhenoGen	Ccl24	PhenoGen
RatGTEx	ENSRNOG00000031162	RatGTEx
SMART	SCY	UniProtKB/TrEMBL
Superfamily-SCOP	Chemokine_IL8	UniProtKB/TrEMBL
UniProt	A0A0G2JYH6_RAT	UniProtKB/TrEMBL
	F6Q1T6	ENTREZGENE, UniProtKB/TrEMBL
	Q5PPP2	ENTREZGENE, UniProtKB/TrEMBL
	Q8K477	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Ccl24	C-C motif chemokine ligand 24	Ccl24	chemokine (C-C motif) ligand 24	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Ccl24	chemokine (C-C motif) ligand 24	Ccl24_predicted	chemokine (C-C motif) ligand 24 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ccl24_predicted	chemokine (C-C motif) ligand 24 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)