Med10 (mediator complex subunit 10)

Gene: Med10 (mediator complex subunit 10) Rattus norvegicus

Analyze

Symbol:

Med10

Name:

mediator complex subunit 10

RGD ID:

1310128

Description:

Contributes to ubiquitin protein ligase activity. Involved in protein ubiquitination. Part of ubiquitin ligase complex. Orthologous to human MED10 (mediator complex subunit 10); PARTICIPATES IN RNA polymerase II transcription pathway; INTERACTS WITH 6-propyl-2-thiouracil; amitrole; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC290939; mediator of RNA polymerase II transcription subunit 10; mediator of RNA polymerase II transcription, subunit 10 homolog (NUT2, S. cerevisiae); RGD1310128; similar to DNA segment, Chr 13, Wayne State University 50, expressed

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MED10 (mediator complex subunit 10)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Med10 (mediator complex subunit 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Med10 (mediator complex subunit 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MED10 (mediator complex subunit 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MED10 (mediator complex subunit 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Med10 (mediator complex subunit 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MED10 (mediator complex subunit 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MED10 (mediator complex subunit 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Med10 (mediator complex subunit 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GRIA1 (glutamate ionotropic receptor AMPA type subunit 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Med10 (mediator complex subunit 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MED10 (mediator complex subunit 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	med10 (mediator complex subunit 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NUT2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	MED10	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mdt-10	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	med10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	35,298,494 - 35,310,163 (-)	NCBI		GRCr8
mRatBN7.2	1	33,470,064 - 33,481,698 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	33,470,066 - 33,475,767 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	33,305,432 - 33,311,100 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	39,304,037 - 39,309,705 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	33,498,226 - 33,503,886 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	36,107,249 - 36,118,887 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	36,107,232 - 36,112,993 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	37,504,217 - 37,515,856 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	3,621,205 - 3,626,895 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	3,621,203 - 3,626,864 (-)	NCBI
Celera	1	32,079,798 - 32,085,458 (-)	NCBI		Celera
Cytogenetic Map	1	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

chrysene (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diclofenac (ISO)

disodium selenite (ISO)

diuron (EXP)

ethanol (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

L-methionine (ISO)

lead(0) (ISO)

methyl methanesulfonate (ISO)

methylparaben (ISO)

nickel sulfate (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

permethrin (EXP)

phenobarbital (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

rotenone (ISO)

silicon dioxide (ISO)

sulfadimethoxine (EXP)

sulindac (EXP)

sunitinib (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of transcription by RNA polymerase II (IBA,ISO)

protein ubiquitination (IDA)

somatic stem cell population maintenance (ISO)

Cellular Component

core mediator complex (ISO)

mediator complex (IBA,ISO)

nucleoplasm (IEA,ISO)

nucleus (ISO)

ubiquitin ligase complex (IDA)

Molecular Function

protein binding (ISO)

transcription coregulator activity (IBA)

ubiquitin protein ligase activity (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA polymerase II transcription pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Mammalian mediator subunit mMED8 is an Elongin BC-interacting protein that can assemble with Cul2 and Rbx1 to reconstitute a ubiquitin ligase.	Brower CS, etal., Proc Natl Acad Sci U S A. 2002 Aug 6;99(16):10353-8. Epub 2002 Jul 29.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	The Mediator complex and transcription regulation.	Poss ZC, etal., Crit Rev Biochem Mol Biol. 2013 Nov-Dec;48(6):575-608. doi: 10.3109/10409238.2013.840259. Epub 2013 Oct 3.
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:15340084	PMID:20720539

Genomics

Comparative Map Data

Med10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	35,298,494 - 35,310,163 (-)	NCBI		GRCr8
mRatBN7.2	1	33,470,064 - 33,481,698 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	33,470,066 - 33,475,767 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	33,305,432 - 33,311,100 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	39,304,037 - 39,309,705 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	33,498,226 - 33,503,886 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	36,107,249 - 36,118,887 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	36,107,232 - 36,112,993 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	37,504,217 - 37,515,856 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	3,621,205 - 3,626,895 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	3,621,203 - 3,626,864 (-)	NCBI
Celera	1	32,079,798 - 32,085,458 (-)	NCBI		Celera
Cytogenetic Map	1	p11	NCBI

MED10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	6,371,874 - 6,378,547 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	6,371,874 - 6,378,571 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	6,371,987 - 6,378,660 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	6,425,039 - 6,431,639 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	6,397,998 - 6,404,598 (-)	NCBI		Celera
Cytogenetic Map	5	p15.31	NCBI
HuRef	5	6,345,867 - 6,352,467 (-)	NCBI		HuRef
CHM1_1	5	6,372,106 - 6,378,706 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	6,300,635 - 6,307,308 (-)	NCBI		T2T-CHM13v2.0

Med10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	69,950,467 - 69,964,221 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	69,950,514 - 69,964,223 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	69,802,348 - 69,816,102 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	69,802,395 - 69,816,104 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	69,948,760 - 69,954,972 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	70,277,254 - 70,283,466 (+)	NCBI		MGSCv36	mm8
Celera	13	72,154,588 - 72,160,710 (+)	NCBI		Celera
Cytogenetic Map	13	C1	NCBI
cM Map	13	35.55	NCBI

Med10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955504	4,184,606 - 4,193,002 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955504	4,186,814 - 4,192,760 (-)	NCBI	ChiLan1.0	ChiLan1.0

MED10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	6,622,054 - 6,628,725 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	4,775,661 - 4,782,318 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	6,695,045 - 6,701,703 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	6,370,806 - 6,377,467 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	6,370,806 - 6,377,467 (-)	Ensembl	panpan1.1		panPan2

MED10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	7,327,370 - 7,334,833 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	11,837,968 - 11,844,881 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	7,238,300 - 7,245,253 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	7,238,323 - 7,244,961 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	7,285,003 - 7,291,940 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	7,265,116 - 7,272,029 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	7,478,463 - 7,485,376 (+)	NCBI		UU_Cfam_GSD_1.0

Med10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	240,362,348 - 240,392,207 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936634	953,567 - 983,426 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MED10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	75,517,023 - 75,524,758 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	75,516,992 - 75,524,761 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	81,876,181 - 81,883,992 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MED10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	6,058,380 - 6,064,916 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	6,057,955 - 6,064,901 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666064	22,694,261 - 22,700,794 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Med10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624751	4,136,776 - 4,141,949 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624751	4,136,615 - 4,141,959 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Med10
67 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	214
Count of miRNA genes:	158
Interacting mature miRNAs:	171
Transcripts:	ENSRNOT00000023161
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	15431621	49361612	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	0.00000072	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	15431621	49361612	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	16206210	49268520	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	20763158	44095856	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1357397	Bw41	Body weight QTL 41	4.19	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
731169	Bp153	Blood pressure QTL 153		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	31050840	33492143	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat

Markers in Region

RH127580

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	33,470,159 - 33,470,352 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	36,107,345 - 36,107,537	NCBI	Rnor6.0
Rnor_5.0	1	37,504,313 - 37,504,505	UniSTS	Rnor5.0
RGSC_v3.4	17	3,621,300 - 3,621,492	UniSTS	RGSC3.4
Celera	1	32,079,894 - 32,080,086	UniSTS
Cytogenetic Map	17	p14	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	35	50	34	19	34			74	35	41	11
Low		8	7	7		7	8	11					8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106097	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006227769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA819805	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB582092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000023161 ⟹ ENSRNOP00000023161

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	33,470,066 - 33,475,767 (-)	Ensembl
Rnor_6.0 Ensembl	1	36,107,232 - 36,112,993 (-)	Ensembl

RefSeq Acc Id:

NM_001106097 ⟹ NP_001099567

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	35,298,494 - 35,304,154 (-)	NCBI
mRatBN7.2	1	33,470,064 - 33,475,724 (-)	NCBI
Rnor_6.0	1	36,107,249 - 36,112,909 (-)	NCBI
Rnor_5.0	1	37,504,217 - 37,515,856 (-)	NCBI
RGSC_v3.4	17	3,621,205 - 3,626,895 (-)	RGD
Celera	1	32,079,798 - 32,085,458 (-)	NCBI

Sequence:

show sequence

CCGAGTCGCTGGGAGCTGTGGCTAAGAGGCGGGTGGGGCTGGCGATGGCGGAGAAGTTTGACCA
TCTAGAGGAGCACCTGGAGAAGTTCGTGGAGAACATTCGGCAGCTCGGCATCATCGTCAGCGAC
TTCCAACCCAGCAGCCAGGCGGGGCTGAGCCAGAAGCTGAACTTCATTGTTACGGGCTTACAGG
ACATAGATAAATGCAGACAGCAGCTACATGATATCACGGTGCCTCTGGAAGTTTTTGAATACAT
TGATCAAGGTCGAAATCCCCAGCTCTACACCAAAGAATGCCTGGAGAGGGCTCTTGCTAAAAAC
GAACAAGTCAAGGGGAAGATCGACACAATGAAGAAATTTAAAAGCCTACTGATTCAGGAACTTT
CTAAAGTGTTTCCAGAAGACATGGCCAAGTATCGGAGCATTCGGGGGGAGGATCACCCGCCTTC
CTAATGTGCGAAGACCCCACATCCTTCTGATAACTGGACTGACCCAGTGAGAGCTGTGCCTGCC
AATGCTGCCTTCCAGCCACGGGACTGGCCTTGCCCCACCTCCCGCTCCCATCCTTTGAGCTGTG
GGACTCGGGGCTGGAGGAGCCGAGCTGTGCCCCACTGTCCCTGCAGCTCTCAGGCCCTTGGGGA
CCAGGCAGGAAGACAGCCTTGCTGAATGTGACATGGGCTTGGGATTCTACTGGACATTTTCTTT
TCATGTACTCTGTTCTGTTACACTGTCCATAAGAGGAAACTTGGTTCTATATTTTACATTTTCA
GATGTTGTGCATAAGAAAATAACTGTTTTCATGGGTTTCAACTCGATATAATAAAGCCTAAAGT
TTACACTGCTCAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006227769 ⟹ XP_006227831

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	35,298,494 - 35,310,163 (-)	NCBI
mRatBN7.2	1	33,470,064 - 33,481,690 (-)	NCBI
Rnor_6.0	1	36,107,249 - 36,118,887 (-)	NCBI
Rnor_5.0	1	37,504,217 - 37,515,856 (-)	NCBI

Sequence:

show sequence

CTTTTCTGGAGCACAATGGTCTGGCATCCAAAGCCATGAGGTGAGGGTGACCCAAAGCCATGAG
GTGACCTGCCTGCAGGGGAATACAGTCTTCAGTCCGAGGTCCGGCTGATATCTACTAATATGGC
AACACTGGAATGAACCATCTTGAAAGCAAGGCCCATGACCTGCAGTGACGCCAGCTGAGCCAAG
TCCATGCAGCAGAGCTTGCTGTAAAAGCCACACAAAGCCCAGTTACCAGGCCCCGCCCCCGACG
AGGCCCAGCCTTCGAAGAAACGGAAGTGGGTTTCCGGAAGCCGGAAGCGGGCGAACACTGGAAC
CCGAGTCGCTGGGAGCTGTGGCTAAGAGGCGGGTGGGGCTGGCGATGGCGGAGAAGTTTGACCA
TCTAGAGGAGCACCTGGAGAAGTTCGTGGAGAACATTCGGCAGCTCGGCATCATCGTCAGCGAC
TTCCAACCCAGCAGCCAGGCGGGGCTGAGCCAGAAGCTGAACTTCATTGTTACGGGCTTACAGG
ACATAGATAAATGCAGACAGCAGCTACATGATATCACGGTGCCTCTGGAAGTTTTTGAATACAT
TGATCAAGGTCGAAATCCCCAGCTCTACACCAAAGAATGCCTGGAGAGGGCTCTTGCTAAAAAC
GAACAAGTCAAGGGGAAGATCGACACAATGAAGAAATTTAAAAGCCTACTGATTCAGGAACTTT
CTAAAGTGTTTCCAGAAGACATGGCCAAGTATCGGAGCATTCGGGGGGAGGATCACCCGCCTTC
CTAATGTGCGAAGACCCCACATCCTTCTGATAACTGGACTGACCCAGTGAGAGCTGTGCCTGCC
AATGCTGCCTTCCAGCCACGGGACTGGCCTTGCCCCACCTCCCGCTCCCATCCTTTGAGCTGTG
GGACTCGGGGCTGGAGGAGCCGAGCTGTGCCCCACTGTCCCTGCAGCTCTCAGGCCCTTGGGGA
CCAGGCAGGAAGACAGCCTTGCTGAATGTGACATGGGCTTGGGATTCTACTGGACATTTTCTTT
TCATGTACTCTGTTCTGTTACACTGTCCATAAGAGGAAACTTGGTTCTATATTTTACATTTTCA
GATGTTGTGCATAAGAAAATAACTGTTTTCATGGGTTTCAACTCGATATAATAAAGCCTAAAGT
TTACACTGCTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099567	(Get FASTA)	NCBI Sequence Viewer
	XP_006227831	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023161
	ENSRNOP00000023161.4

RefSeq Acc Id:	NP_001099567 ⟸ NM_001106097
- UniProtKB:	D4A7K6 (UniProtKB/TrEMBL), A6JV08 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDITVP LEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIR GEDHPPS hide sequence

RefSeq Acc Id:	XP_006227831 ⟸ XM_006227769
- Peptide Label:	isoform X1
- UniProtKB:	D4A7K6 (UniProtKB/TrEMBL), A6JV08 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDITVP LEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIR GEDHPPS hide sequence

RefSeq Acc Id:

ENSRNOP00000023161 ⟸ ENSRNOT00000023161

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A7K6-F1-model_v2	AlphaFold	D4A7K6	1-135	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689573

Promoter ID:

EPDNEW_R97

Type:

initiation region

Name:

Med10_1

Description:

mediator complex subunit 10

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	36,112,907 - 36,112,967	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310128	AgrOrtholog
BioCyc Gene	G2FUF-61876	BioCyc
Ensembl Genes	ENSRNOG00000017150	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023161	ENTREZGENE
	ENSRNOT00000023161.8	UniProtKB/TrEMBL
InterPro	Mediator_Med10	UniProtKB/TrEMBL
KEGG Report	rno:290939	UniProtKB/TrEMBL
NCBI Gene	290939	ENTREZGENE
PANTHER	MEDIATOR OF RNA POLYMERASE II TRANSCRIPTION SUBUNIT 10	UniProtKB/TrEMBL
	MEDIATOR OF RNA POLYMERASE II TRANSCRIPTION SUBUNIT 10	UniProtKB/TrEMBL
Pfam	Med10	UniProtKB/TrEMBL
PhenoGen	Med10	PhenoGen
RatGTEx	ENSRNOG00000017150	RatGTEx
UniProt	A6JV08	ENTREZGENE, UniProtKB/TrEMBL
	D4A7K6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-24	Med10	mediator complex subunit 10	Med10	mediator of RNA polymerase II transcription, subunit 10 homolog (NUT2, S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-27	Med10	mediator of RNA polymerase II transcription, subunit 10 homolog (NUT2, S. cerevisiae)	RGD1310128_predicted	similar to DNA segment, Chr 13, Wayne State University 50, expressed (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1310128_predicted	similar to DNA segment, Chr 13, Wayne State University 50, expressed (predicted)	LOC290939_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC290939_predicted	similar to DNA segment, Chr 13, Wayne State University 50, expressed (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations