Hpdl (4-hydroxyphenylpyruvate dioxygenase-like)

Gene: Hpdl (4-hydroxyphenylpyruvate dioxygenase-like) Rattus norvegicus

Analyze

Symbol:

Hpdl

Name:

4-hydroxyphenylpyruvate dioxygenase-like

RGD ID:

1310014

Description:

Predicted to enable 4-hydroxyphenylpyruvate dioxygenase activity and metal ion binding activity. Predicted to be involved in aromatic amino acid metabolic process. Predicted to be located in mitochondrion. Human ortholog(s) of this gene implicated in hereditary spastic paraplegia 83. Orthologous to human HPDL (4-hydroxyphenylpyruvate dioxygenase like); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

4-hydroxyphenylpyruvate dioxygenase-like protein; Gloxd1; glyoxalase domain containing 1; glyoxalase domain-containing protein 1; LOC313521; RGD1310014; similar to RIKEN cDNA A830048M07

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	135,523,258 - 135,524,864 (-)	NCBI		GRCr8
mRatBN7.2	5	130,286,627 - 130,288,233 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	130,286,631 - 130,288,233 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	132,917,327 - 132,918,933 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	134,671,930 - 134,673,536 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	134,694,331 - 134,695,937 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	135,675,826 - 135,677,432 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	135,675,832 - 135,677,432 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	139,471,945 - 139,473,551 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	137,116,378 - 137,117,984 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	137,121,605 - 137,123,210 (-)	NCBI
Celera	5	128,813,296 - 128,814,902 (-)	NCBI		Celera
Cytogenetic Map	5	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease dominant intermediate C (ISO)

developmental and epileptic encephalopathy (ISO)

early infantile epileptic encephalopathy (ISO)

familial adenomatous polyposis 2 (ISO)

genetic disease (ISO)

hereditary spastic paraplegia 83 (ISO)

neurodegenerative disease (ISS)

Neurodevelopmental Disorder with Progressive Spasticity and Brain White Matter Abnormalities (ISO)

paraplegia (ISO)

spastic ataxia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aconitine (EXP)

acrylamide (EXP)

all-trans-retinoic acid (EXP,ISO)

amitrole (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

atrazine (EXP,ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

carbon nanotube (ISO)

chromium(6+) (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cypermethrin (ISO)

dexamethasone (ISO)

dioxygen (ISO)

diquat (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethyl methanesulfonate (ISO)

formaldehyde (ISO)

furan (EXP)

indometacin (ISO)

iron dichloride (ISO)

ketamine (EXP)

methimazole (EXP)

methyl methanesulfonate (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (EXP,ISO)

vincristine (ISO)

vorinostat (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aromatic amino acid metabolic process (IEA)

Cellular Component

mitochondrion (ISO,ISS)

Molecular Function

4-hydroxyphenylpyruvate dioxygenase activity (IEA)

metal ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334

Genomics

Comparative Map Data

Hpdl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	135,523,258 - 135,524,864 (-)	NCBI		GRCr8
mRatBN7.2	5	130,286,627 - 130,288,233 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	130,286,631 - 130,288,233 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	132,917,327 - 132,918,933 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	134,671,930 - 134,673,536 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	134,694,331 - 134,695,937 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	135,675,826 - 135,677,432 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	135,675,832 - 135,677,432 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	139,471,945 - 139,473,551 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	137,116,378 - 137,117,984 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	137,121,605 - 137,123,210 (-)	NCBI
Celera	5	128,813,296 - 128,814,902 (-)	NCBI		Celera
Cytogenetic Map	5	q35	NCBI

HPDL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	45,326,895 - 45,328,710 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	45,326,895 - 45,328,710 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	45,792,567 - 45,794,382 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	45,565,132 - 45,566,934 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	44,075,922 - 44,077,724 (+)	NCBI		Celera
Cytogenetic Map	1	p34.1	NCBI
HuRef	1	43,904,200 - 43,906,002 (+)	NCBI		HuRef
CHM1_1	1	45,909,348 - 45,911,150 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	45,198,451 - 45,200,266 (+)	NCBI		T2T-CHM13v2.0

Hpdl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	116,677,104 - 116,678,705 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	116,677,101 - 116,678,904 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	116,819,907 - 116,821,508 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	116,819,904 - 116,821,707 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	116,492,512 - 116,494,113 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	116,317,839 - 116,319,440 (-)	NCBI		MGSCv36	mm8
Celera	4	115,559,324 - 115,560,925 (-)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	53.35	NCBI

Hpdl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955464	12,936,996 - 12,940,050 (-)	NCBI	ChiLan1.0	ChiLan1.0

HPDL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	181,480,018 - 181,481,687 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	180,621,287 - 180,623,136 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	44,629,560 - 44,631,394 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	45,988,044 - 45,989,883 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	45,988,494 - 45,989,609 (+)	Ensembl	panpan1.1		panPan2

HPDL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	15,019,273 - 15,028,932 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	15,027,472 - 15,028,671 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	15,140,618 - 15,150,283 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	15,174,596 - 15,184,265 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	15,182,797 - 15,183,996 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	14,971,693 - 14,981,350 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	15,039,578 - 15,049,242 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	15,111,689 - 15,121,352 (-)	NCBI		UU_Cfam_GSD_1.0

Hpdl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	60,657,068 - 60,658,485 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	26,481,883 - 26,482,998 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	26,481,300 - 26,483,143 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HPDL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	166,012,601 - 166,014,323 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	166,012,590 - 166,015,051 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	153,420,659 - 153,423,107 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HPDL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	87,463,202 - 87,465,467 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	87,463,636 - 87,464,748 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	29,496,866 - 29,498,911 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hpdl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624906	1,236,450 - 1,237,565 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624906	1,235,307 - 1,238,381 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hpdl
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	82
Count of miRNA genes:	72
Interacting mature miRNAs:	73
Transcripts:	ENSRNOT00000024393
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	124160767	133749643	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	125392826	139989768	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	128033842	133011550	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat

Markers in Region

BI304156

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	130,288,704 - 130,288,891 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	135,677,904 - 135,678,090	NCBI	Rnor6.0
Rnor_5.0	5	139,474,023 - 139,474,209	UniSTS	Rnor5.0
RGSC_v3.4	5	137,118,456 - 137,118,642	UniSTS	RGSC3.4
Celera	5	128,815,374 - 128,815,560	UniSTS
RH 3.4 Map	5	823.3	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH137167

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	130,286,628 - 130,286,848 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	135,675,828 - 135,676,047	NCBI	Rnor6.0
Rnor_5.0	5	139,471,947 - 139,472,166	UniSTS	Rnor5.0
RGSC_v3.4	5	137,116,380 - 137,116,599	UniSTS	RGSC3.4
Celera	5	128,813,298 - 128,813,517	UniSTS
RH 3.4 Map	5	853.1	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		5					2	2					2
Low	3	38	40	24	17	24	6	9	74	35	39	10	6
Below cutoff			16	16	2	16					2	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC126292	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000024393 ⟹ ENSRNOP00000024393

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	130,286,631 - 130,288,233 (-)	Ensembl
Rnor_6.0 Ensembl	5	135,675,832 - 135,677,432 (-)	Ensembl

RefSeq Acc Id:

NM_001014068 ⟹ NP_001014090

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	135,523,258 - 135,524,864 (-)	NCBI
mRatBN7.2	5	130,286,627 - 130,288,233 (-)	NCBI
Rnor_6.0	5	135,675,826 - 135,677,432 (-)	NCBI
Rnor_5.0	5	139,471,945 - 139,473,551 (-)	NCBI
RGSC_v3.4	5	137,116,378 - 137,117,984 (-)	RGD
Celera	5	128,813,296 - 128,814,902 (-)	RGD

Sequence:

show sequence

AGAACCTGTGGTCCTCGGCCGGCTTCTGGTTGAAGTGGCGCTGCAGCAAGGATAAGTCCCCCAA
AGTTTGACTTCGTGACCTCTGTTCGTAGTCTCAGAAAAGACTAAAGAACGCGCTCTTCGGATAG
ACCAGGACTCCGTCGGCTTCCAACAATTAATCCTGGAGCAAGAGTCTTTGAATTCTAAACGGGT
GAGCGGCCCCAGAAGAACAGATCCGGGTGGCCGGCAATTGGGCTCGCCATGGCTGCGCCCGCCC
GCCGTCTGTGTCACATCGCCTTCCATGTGCCGGCTGGGCAGCCCCTAGCGAGAGACTTACAACG
CATCTTCGGCTTCCAGCCCCTGGCTGTGCGGGAAGCAGGCGGCTGGAGACAGCTGGCCCTGCGC
AGCGGGGACGCTGTCTTTCTAGTGAATGAGGGTACCGGGCCGCGGGAGCCACTGTATGGCCTGG
ACCCTCATCACTCGGTGCCCAGCGCAACGAACCTGTGCTTCGACGTGGAGGATGTGGACCGCGC
CGCCCGGGCACTGGCGGCTCGCGGCTGCATCATGCCGGTACCACCCACTAGGGTGAGAGATGCA
CAGGGCACAGCCACCTACACAGTGGTCAGCTCTCCGGCTGGTAATCTAAGCCTTACCTTGCTGC
AGCGTGCTGGCTATCGAGGATCTTTCCTGCCCGGGTTCAGACCTCTGCCTTGCACTCCTGGCCC
GGGCTGGGTCAGCCACGTGGACCACTTGACCTTGGCCTGCACCTCAGGCAGCTCCCCTACACTT
ATGCGTTGGTTCCACAACTGCCTAGGGTTTCATCATTTACCGCTGAGCCCAGGTGAGGATCCGG
AGCTGGGCCTCAAGGTGGCTGTAGGGTCTGGGCGAGGGGGACTGCGGCTTACTGCCTTGCAGAC
TCTGCCAAATAGTACTGTCCCCACCCTTGTGCTGGCAGAGTCCCTCCCGGGACTCACCAGCGAA
CAGGACCAGGTAGAACAATTTCTAACCCGGCACGGAGGGCCAGGCCTGCAGCACGTAGGACTGT
ACACTCCTAACATCATAGATGCTTCTGAAGGAATGGCGAAGGCGGGAGGCCGGCTCCTGACTCC
TCCTGAAGCTTATTACCAGCAGCCCGGCAAAGAGGAACAAATCTTAGCCTCAGGGCACAAGCCT
AGCTTTCTAGAACGGCAGGGAATCCTGCTAGATGGAGATAAAGATGAGTTTTTGCTTCAAGTCT
TCACCAAGTCCCTCTTTGATGAGGACACTTTCTTCCTGGAACTGATTGAGAGACAGGGGGCCAC
AGGCTTTGGCCAGAACAACATTCGTGCACTATGGCAGTCGGTGCAAGAGGAAGCTGCCAGGGCT
CAGGGAACCTAACCCCAGCTAGAAATGGGAGTTGCCACTTGTCCTTGGTGCTCTGAGGAGTCCA
GCACAGGCCTGCTGGAACTGACACATCCCGCAGGACCACACCTCCACAGAATTACACCCAAATA
AAGGCTATCATTCCCTCAGGGGCAGGGTGATCTCATCCCAAGCAGTCCCTGAGATGGGATTTAA
AATAGTAACAACCTCTAAAATGGCTAACACGTTTAGGTAATGTAAATAAAGGAACAGGCCATAG
GACACAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001014090	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83702	(Get FASTA)	NCBI Sequence Viewer
	EDL90243	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024393
	ENSRNOP00000024393.2
	ENSRNOP00055020513
	ENSRNOP00060043944
	ENSRNOP00065023807
GenBank Protein	Q5XIH9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014090 ⟸ NM_001014068

- UniProtKB:

Q5XIH9 (UniProtKB/Swiss-Prot), A6JZB0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAPARRLCHIAFHVPAGQPLARDLQRIFGFQPLAVREAGGWRQLALRSGDAVFLVNEGTGPRE
PLYGLDPHHSVPSATNLCFDVEDVDRAARALAARGCIMPVPPTRVRDAQGTATYTVVSSPAGNL
SLTLLQRAGYRGSFLPGFRPLPCTPGPGWVSHVDHLTLACTSGSSPTLMRWFHNCLGFHHLPLS
PGEDPELGLKVAVGSGRGGLRLTALQTLPNSTVPTLVLAESLPGLTSEQDQVEQFLTRHGGPGL
QHVGLYTPNIIDASEGMAKAGGRLLTPPEAYYQQPGKEEQILASGHKPSFLERQGILLDGDKDE
FLLQVFTKSLFDEDTFFLELIERQGATGFGQNNIRALWQSVQEEAARAQGT

hide sequence

RefSeq Acc Id:

ENSRNOP00000024393 ⟸ ENSRNOT00000024393

Protein Domains

VOC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XIH9-F1-model_v2	AlphaFold	Q5XIH9	1-371	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310014	AgrOrtholog
BioCyc Gene	G2FUF-40235	BioCyc
Ensembl Genes	ENSRNOG00000018143	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055014632	UniProtKB/Swiss-Prot
	ENSRNOG00060030454	UniProtKB/Swiss-Prot
	ENSRNOG00065017900	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000024393	ENTREZGENE
	ENSRNOT00000024393.4	UniProtKB/Swiss-Prot
	ENSRNOT00055025087	UniProtKB/Swiss-Prot
	ENSRNOT00060052859	UniProtKB/Swiss-Prot
	ENSRNOT00065029963	UniProtKB/Swiss-Prot
Gene3D-CATH	2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7190108	IMAGE-MGC_LOAD
InterPro	4OHPhenylPyrv_dOase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	4OHPhenylPyrv_dOase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	4OHPhenylPyrv_dOase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyas_Bleomycin-R_OHBP_Dase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VOC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:313521	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:94580	IMAGE-MGC_LOAD
NCBI Gene	313521	ENTREZGENE
PANTHER	4-HYDROXYPHENYLPYRUVATE DIOXYGENASE	UniProtKB/TrEMBL
	4-HYDROXYPHENYLPYRUVATE DIOXYGENASE-LIKE PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11959	UniProtKB/Swiss-Prot
PhenoGen	Hpdl	PhenoGen
PIRSF	HPP_dOase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	VOC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018143	RatGTEx
	ENSRNOG00055014632	RatGTEx
	ENSRNOG00060030454	RatGTEx
	ENSRNOG00065017900	RatGTEx
Superfamily-SCOP	Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6JZB0	ENTREZGENE, UniProtKB/TrEMBL
	HPDL_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Hpdl	4-hydroxyphenylpyruvate dioxygenase-like	Gloxd1	glyoxalase domain containing 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Gloxd1	glyoxalase domain containing 1	RGD1310014	similar to RIKEN cDNA A830048M07	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1310014	similar to RIKEN cDNA A830048M07	RGD1310014_predicted	similar to RIKEN cDNA A830048M07 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1310014_predicted	similar to RIKEN cDNA A830048M07 (predicted)	LOC313521_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC313521_predicted	similar to RIKEN cDNA A830048M07 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM