Gns (glucosamine (N-acetyl)-6-sulfatase)

Gene: Gns (glucosamine (N-acetyl)-6-sulfatase) Rattus norvegicus

Analyze

Symbol:

Gns

Name:

glucosamine (N-acetyl)-6-sulfatase

RGD ID:

1305877

Description:

Enables N-acetylglucosamine-6-sulfatase activity; glycosaminoglycan binding activity; and sulfate binding activity. Involved in keratan sulfate catabolic process. Predicted to be located in lysosome. Human ortholog(s) of this gene implicated in mucopolysaccharidosis III and mucopolysaccharidosis type IIID. Orthologous to human GNS (glucosamine (N-acetyl)-6-sulfatase); PARTICIPATES IN glycosaminoglycan degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC100909505; LOC299825; N-acetylglucosamine-6-sulfatase; N-acetylglucosamine-6-sulfatase-like

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNS (glucosamine (N-acetyl)-6-sulfatase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Gns (glucosamine (N-acetyl)-6-sulfatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gns (glucosamine (N-acetyl)-6-sulfatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNS (glucosamine (N-acetyl)-6-sulfatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNS (glucosamine (N-acetyl)-6-sulfatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gns (glucosamine (N-acetyl)-6-sulfatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNS (glucosamine (N-acetyl)-6-sulfatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNS (glucosamine (N-acetyl)-6-sulfatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gns (glucosamine (N-acetyl)-6-sulfatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GNS (glucosamine (N-acetyl)-6-sulfatase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gns (glucosamine (N-acetyl)-6-sulfatase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gnsa (glucosamine (N-acetyl)-6-sulfatase a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18278	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gns	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	58,774,625 - 58,808,650 (+)	NCBI		GRCr8
mRatBN7.2	7	56,889,148 - 56,923,173 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	56,889,232 - 56,923,151 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	58,800,291 - 58,829,841 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	61,003,226 - 61,032,786 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	60,780,851 - 60,810,415 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	63,467,027 - 63,501,054 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	63,467,216 - 63,499,353 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	7	65,616,177 - 65,653,052 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	63,690,750 - 63,724,944 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	60,672,492 - 60,702,306 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	60,693,221 - 60,723,036 (+)	NCBI
Celera	7	53,633,706 - 53,657,136 (+)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

genetic disease (ISO)

mucopolysaccharidosis III (ISO,ISS)

mucopolysaccharidosis type IIID (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

all-trans-retinoic acid (ISO)

aminoglutethimide (ISO)

antirheumatic drug (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

elemental selenium (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

ethyl methanesulfonate (ISO)

fenvalerate (EXP)

formaldehyde (ISO)

gentamycin (EXP)

glafenine (EXP)

graphite (EXP)

heparan sulfate (ISO)

heparin (ISO)

isoprenaline (ISO)

keratan sulfate (ISO)

methyl methanesulfonate (ISO)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

picoxystrobin (ISO)

propiconazole (ISO)

resveratrol (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

titanium dioxide (ISO)

troglitazone (ISO)

tungsten (ISO)

tunicamycin (ISO)

valdecoxib (EXP)

valproic acid (ISO)

Yessotoxin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

keratan sulfate catabolic process (IDA)

Cellular Component

lysosome (ISO)

Molecular Function

glycosaminoglycan binding (IBA,IPI)

metal ion binding (IEA)

N-acetylglucosamine-6-sulfatase activity (IBA,IDA)

protein binding (ISO)

sulfate binding (IPI)

sulfuric ester hydrolase activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

glycosaminoglycan degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Intralysosomal formation and metabolic fate of N-acetylglucosamine 6-sulfate from keratan sulfate.	Fuchs W, etal., Eur J Biochem. 1985 Sep 16;151(3):551-6.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Genomic basis of mucopolysaccharidosis type IIID (MIM 252940) revealed by sequencing of GNS encoding N-acetylglucosamine-6-sulfatase.	Mok A, etal., Genomics. 2003 Jan;81(1):1-5.
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15962010	PMID:16174644	PMID:23376485	PMID:23533145	PMID:29514215

Genomics

Comparative Map Data

Gns
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	58,774,625 - 58,808,650 (+)	NCBI		GRCr8
mRatBN7.2	7	56,889,148 - 56,923,173 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	56,889,232 - 56,923,151 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	58,800,291 - 58,829,841 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	61,003,226 - 61,032,786 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	60,780,851 - 60,810,415 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	63,467,027 - 63,501,054 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	63,467,216 - 63,499,353 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	7	65,616,177 - 65,653,052 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	63,690,750 - 63,724,944 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	60,672,492 - 60,702,306 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	60,693,221 - 60,723,036 (+)	NCBI
Celera	7	53,633,706 - 53,657,136 (+)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

GNS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	64,713,449 - 64,759,406 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	64,713,445 - 64,759,431 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	65,107,229 - 65,153,186 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	63,393,489 - 63,439,479 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	63,393,490 - 63,439,479	NCBI
Celera	12	64,772,049 - 64,818,041 (-)	NCBI		Celera
Cytogenetic Map	12	q14.3	NCBI
HuRef	12	62,157,915 - 62,203,861 (-)	NCBI		HuRef
CHM1_1	12	65,074,143 - 65,120,149 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	64,692,475 - 64,738,233 (-)	NCBI		T2T-CHM13v2.0

Gns
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	121,200,995 - 121,233,159 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	121,200,995 - 121,233,154 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	121,365,090 - 121,397,254 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	121,365,090 - 121,397,249 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	120,802,146 - 120,834,301 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	120,768,150 - 120,800,305 (+)	NCBI		MGSCv36	mm8
Celera	10	123,737,286 - 123,777,799 (+)	NCBI		Celera
Cytogenetic Map	10	D2	NCBI
cM Map	10	69.62	NCBI

Gns
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955458	11,471,376 - 11,500,838 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955458	11,471,376 - 11,500,793 (-)	NCBI	ChiLan1.0	ChiLan1.0

GNS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	29,609,501 - 29,655,436 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	29,606,360 - 29,652,210 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	24,164,127 - 24,209,963 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	24,667,603 - 24,712,939 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	24,667,603 - 24,712,939 (+)	Ensembl	panpan1.1		panPan2

GNS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	7,363,628 - 7,415,618 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	7,366,247 - 7,507,270 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	7,299,232 - 7,351,429 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	7,474,090 - 7,526,469 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	7,449,649 - 7,526,493 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	7,339,256 - 7,391,535 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	7,591,891 - 7,644,088 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	7,722,471 - 7,774,680 (-)	NCBI		UU_Cfam_GSD_1.0

Gns
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	51,099,523 - 51,137,683 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936545	2,971,870 - 3,010,566 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936545	2,974,627 - 3,010,586 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	29,128,760 - 29,190,230 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	29,128,754 - 29,190,283 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	32,134,222 - 32,173,457 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	60,390,479 - 60,434,266 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	60,388,883 - 60,434,233 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	185,341,130 - 185,386,269 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gns
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624802	3,636,906 - 3,666,033 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624802	3,637,250 - 3,668,698 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gns
196 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	205
Count of miRNA genes:	127
Interacting mature miRNAs:	136
Transcripts:	ENSRNOT00000006566, ENSRNOT00000064349
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	15573889	60573889	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	17004598	62004598	Rat
10755451	Coatc11	Coat color QTL 11		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	17944357	62944357	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	29409683	74409683	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	31112832	76112832	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	34293282	79293282	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	34293282	79293282	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	37960569	82960569	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
10059605	Kidm47	Kidney mass QTL 47	2.91	0.05	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	47251783	65728867	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat

Markers in Region

RH132435

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	56,917,307 - 56,918,843 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	65,647,178 - 65,648,713	NCBI	Rnor6.0
Rnor_6.0	7	63,495,193 - 63,496,728	NCBI	Rnor6.0
Rnor_5.0	7	63,719,083 - 63,720,618	UniSTS	Rnor5.0
Rnor_5.0	7	65,855,119 - 65,856,654	UniSTS	Rnor5.0
RGSC_v3.4	7	60,700,564 - 60,702,099	UniSTS	RGSC3.4
RH 3.4 Map	7	501.5	UniSTS
Cytogenetic Map	7	q22	UniSTS

AU046507

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	56,909,948 - 56,910,093 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	65,637,111 - 65,637,255	NCBI	Rnor6.0
Rnor_6.0	7	63,487,835 - 63,487,979	NCBI	Rnor6.0
Rnor_5.0	7	63,711,725 - 63,711,869	UniSTS	Rnor5.0
Rnor_5.0	7	65,845,052 - 65,845,196	UniSTS	Rnor5.0
RGSC_v3.4	7	60,693,205 - 60,693,349	UniSTS	RGSC3.4
Celera	7	53,654,423 - 53,654,567	UniSTS
Cytogenetic Map	7	q22	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001011989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001414922	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC087741	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158826	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BN000742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000006566 ⟹ ENSRNOP00000006566

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	56,894,902 - 56,923,151 (+)	Ensembl
Rnor_6.0 Ensembl	7	65,616,177 - 65,653,052 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000064349 ⟹ ENSRNOP00000062823

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	56,889,232 - 56,923,151 (+)	Ensembl
Rnor_6.0 Ensembl	7	63,467,216 - 63,499,353 (+)	Ensembl

RefSeq Acc Id:

NM_001011989 ⟹ NP_001011989

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	58,774,625 - 58,804,527 (+)	NCBI
mRatBN7.2	7	56,889,148 - 56,919,050 (+)	NCBI
Rnor_6.0	7	63,467,122 - 63,496,935 (+)	NCBI
Rnor_5.0	7	63,690,750 - 63,724,944 (+)	NCBI
RGSC_v3.4	7	60,672,492 - 60,702,306 (+)	RGD
Celera	7	53,633,706 - 53,657,136 (+)	RGD

Sequence:

show sequence

CCGCGGAGCGTGGCGGCCATGCGGCTCCCGTCCGCAGCTGGGCCCGGGCCGGGCTGTCCCAGCC
GCCTGCCCGCGCTGCTGCTACTGCCGCTGCTGAGCGGCTGCCTGGGGCTCGTGGGGGCGGCTCG
CAGGCCCAACGTGTTGCTGCTGCTCACGGACGACCAGGACGCGGAGCTCGGCGGCATGACCCCA
CTAAAGAAAACCAAGGCCCTCATCGGAGAGAAGGGGATGACTTTCTCCAGCGCTTATGTGCCCA
GTGCTCTCTGCTGCCCCAGCAGAGCCAGCATCCTGACTGGGAAGTACCCACACAACCATCACGT
CGTCAACAACACTTTGGAGGGGAACTGCAGTAGCAAGTCCTGGCAGAAGATCCAGGAGCCATAC
ACCTTCCCAGCGATCCTTAAGTTGGTGTGCGGCTATCAAACCTTTTTTGCTGGGAAGTATTTAA
ATGAGTATGGAGCCCCAGATGCGGGTGGACTGGAGCACGTGCCTCTGGGCTGGAGTTACTGGTA
TGCCCTGGAAAAGAATTCTAAATACTATAACTACACCCTCTCTATCAACGGGAAGGCACGCAGA
CATGGCGAGAACTATAGCGTGGACTACCTGACAGACGTTCTGGCCAATCTCTCCCTGGACTTCC
TGGACTACAAGTCCAACTCTGAGCCATTCTTCATGATGATCTCCACTCCAGCGCCCCACTCACC
GTGGACAGCCGCACCTCAGTACCAGAAGGCTTTCCCCAATGTCATCGCACCGAGAAACAAGAAC
TTCAACATCCATGGGACGAACAAGCACTGGTTAATTAGGCAAGCCAAGACTCCCATGACGAATT
CCTCAATAAAGTTCTTAGATGACGCCTTCAGAAGGAGGTGGCAAACTCTGCTCTCAGTTGACGA
TCTTGTGGAAAAACTGGTGAAGAGATTGGACTCGACTGGTGAGCTGGACAACACGTACATCTTC
TATACCTCAGACAATGGCTACCATACAGGGCAGTTCTCTTTGCCAATAGACAAACGACAACTCT
ATGAGTTTGATATCAAAGTTCCACTGTTGGTTCGAGGGCCTGGGATCAAACCAAACCAGACAAG
CAAGATGCTGGTCTCCAATATTGACTTGGGTCCCACCATCCTGGACCTCGCTGGCTATGACCTG
AACAAGACACAGATGGACGGGACATCCCTGCTGCCCATCCTGAAAGGGGACGGTAACTTAACCT
GGAGGTCAGATGTCCTGGTGGAATATCAAGGAGAAGGCCGTAATGTCACCGACCCGACCTGCCC
TTCTTTGAGTCCTGGAGTGTCTCAATGTTTCCCGGACTGTGTGTGTGAGGACGCGTACAACAAT
ACATATGCTTGTGTGAGGACACTGTCATCCATGTGGAACCTACAGTACTGTGAGTTCGACGACC
AGGAGGTATTTGTAGAAGTCTATAACATAACTGCAGATCCAGACCAGATCACCAACATTGCTAA
GAGTATAGACCCCGAGCTTTTGGGAAAGATGAACTATCGGCTGATGATGCTCCAGTCCTGTTCC
GGGCCAACCTGTCGCACTCCGGGGGTCTTTGACCCTGGGTAAGCGTCTTTCTTCAGTGACTCTG
CCATCGTCTCGAGAGGCCAGGCTCCTTTTTGCTTTGAGCAGTGTTTAATTCTTCTGCTTTGTTG
AGAGAATGCTGTGTTCCTGCCGCGTCAGCTTGTTTTGTTGGGAAAATAAATTAGCCCTGTACCT
TTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001414922 ⟹ NP_001401851

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	58,774,625 - 58,808,650 (+)	NCBI
mRatBN7.2	7	56,889,148 - 56,923,173 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001011989	(Get FASTA)	NCBI Sequence Viewer
	NP_001401851	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87741	(Get FASTA)	NCBI Sequence Viewer
	CAI84988	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006566.8
	ENSRNOP00000062823
	ENSRNOP00000062823.4

RefSeq Acc Id:	NP_001011989 ⟸ NM_001011989
- Peptide Label:	isoform 2 precursor
- UniProtKB:	Q5M918 (UniProtKB/TrEMBL), A0A8J8YF65 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRLPSAAGPGPGCPSRLPALLLLPLLSGCLGLVGAARRPNVLLLLTDDQDAELGGMTPLKKTKA LIGEKGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPYTFPAIL KLVCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARRHGENYS VDYLTDVLANLSLDFLDYKSNSEPFFMMISTPAPHSPWTAAPQYQKAFPNVIAPRNKNFNIHGT NKHWLIRQAKTPMTNSSIKFLDDAFRRRWQTLLSVDDLVEKLVKRLDSTGELDNTYIFYTSDNG YHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVSNIDLGPTILDLAGYDLNKTQMD GTSLLPILKGDGNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVR TLSSMWNLQYCEFDDQEVFVEVYNITADPDQITNIAKSIDPELLGKMNYRLMMLQSCSGPTCRT PGVFDPG hide sequence

RefSeq Acc Id:

ENSRNOP00000062823 ⟸ ENSRNOT00000064349

RefSeq Acc Id:

ENSRNOP00000006566 ⟸ ENSRNOT00000006566

RefSeq Acc Id:	NP_001401851 ⟸ NM_001414922
- Peptide Label:	isoform 1 precursor
- UniProtKB:	F7F393 (UniProtKB/TrEMBL), F7EQ81 (UniProtKB/TrEMBL), Q32KJ5 (UniProtKB/TrEMBL), A0A8J8YF65 (UniProtKB/TrEMBL)

Protein Domains

Sulfatase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q32KJ5-F1-model_v2	AlphaFold	Q32KJ5	1-544	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305877	AgrOrtholog
BioCyc Gene	G2FUF-33873	BioCyc
Ensembl Genes	ENSRNOG00000046159	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00000047350	Ensembl
Ensembl Transcript	ENSRNOT00000006566.7	UniProtKB/TrEMBL
	ENSRNOT00000064349	ENTREZGENE
	ENSRNOT00000064349.4	UniProtKB/TrEMBL
Gene3D-CATH	3.40.720.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7314130	IMAGE-MGC_LOAD
InterPro	Alkaline_phosphatase_core	UniProtKB/TrEMBL
	GlcNAc_6-SO4ase	UniProtKB/TrEMBL
	Sulfatase	UniProtKB/TrEMBL
	Sulfatase_CS	UniProtKB/TrEMBL
KEGG Report	rno:299825	UniProtKB/TrEMBL
MGC_CLONE	MGC:105737	IMAGE-MGC_LOAD
NCBI Gene	299825	ENTREZGENE
PANTHER	N-ACETYLGLUCOSAMINE-6-SULFATASE FAMILY MEMBER	UniProtKB/TrEMBL
	PTHR43108:SF5	UniProtKB/TrEMBL
Pfam	Sulfatase	UniProtKB/TrEMBL
PhenoGen	Gns	PhenoGen
PIRSF	G6S	UniProtKB/TrEMBL
PROSITE	PROKAR_LIPOPROTEIN	UniProtKB/TrEMBL
	SULFATASE_1	UniProtKB/TrEMBL
	SULFATASE_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000046159	RatGTEx
	ENSRNOG00000047350	RatGTEx
Superfamily-SCOP	Alkaline_phosphatase_core	UniProtKB/TrEMBL
UniProt	A0A8J8YF65	ENTREZGENE, UniProtKB/TrEMBL
	F7EQ81	ENTREZGENE
	F7F393	ENTREZGENE
	Q32KJ5	ENTREZGENE, UniProtKB/TrEMBL
	Q5M918	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	F7EQ81	UniProtKB/TrEMBL
	F7F393	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Gns	glucosamine (N-acetyl)-6-sulfatase	LOC100909505	N-acetylglucosamine-6-sulfatase-like	Data merged from RGD:6503308	737654	PROVISIONAL
2013-05-24	Gns	glucosamine (N-acetyl)-6-sulfatase	LOC688338	similar to glucosamine (N-acetyl)-6-sulfatase	Data merged from RGD:1590034	1643240	APPROVED
2012-07-05	LOC100909505	N-acetylglucosamine-6-sulfatase-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC688338	similar to glucosamine (N-acetyl)-6-sulfatase			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-12-06	Gns	glucosamine (N-acetyl)-6-sulfatase	Gns_predicted	glucosamine (N-acetyl)-6-sulfatase (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Gns_predicted	glucosamine (N-acetyl)-6-sulfatase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)