Rell2 (RELT-like 2) - Rat Genome Database

Name: Rell2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Rell2 (RELT-like 2) Rattus norvegicus

Analyze

Symbol:

Rell2

Name:

RELT-like 2

RGD ID:

1305276

Description:

Predicted to enable collagen binding activity. Predicted to be involved in positive regulation of cell-substrate adhesion and positive regulation of p38MAPK cascade. Predicted to be located in basement membrane. Orthologous to human RELL2 (RELT like 2); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC361313; MGC109265; RELT-like protein 2; RGD1305276; similar to RIKEN cDNA 4631403P03

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RELL2 (RELT like 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rell2 (RELT-like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rell2 (RELT like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RELL2 (RELT like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RELL2 (RELT like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rell2 (RELT like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RELL2 (RELT like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RELL2 (RELT like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rell2 (RELT like 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RELL2 (RELT like 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rell2 (RELT-like 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rell2 (RELT like 2)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rell2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	crygdl.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	30,041,204 - 30,045,193 (+)	NCBI		GRCr8
mRatBN7.2	18	29,789,996 - 29,793,986 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	29,790,415 - 29,793,986 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	29,894,721 - 29,898,291 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	30,656,919 - 30,660,489 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	29,992,265 - 29,995,834 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	31,094,965 - 31,098,536 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	31,094,965 - 31,098,536 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	30,783,005 - 30,786,576 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	30,876,604 - 30,880,175 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	30,903,249 - 30,906,821 (+)	NCBI
Celera	18	29,435,000 - 29,438,570 (+)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,4-methylenedioxymethamphetamine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

amitrole (EXP)

amphetamine (EXP)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP)

C60 fullerene (EXP)

cisplatin (ISO)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

dibutyl phthalate (EXP)

dimethylarsinic acid (ISO)

endosulfan (EXP)

fipronil (EXP)

folic acid (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

Licochalcone B (ISO)

methimazole (EXP)

methylarsonic acid (ISO)

N-methyl-4-phenylpyridinium (EXP)

paracetamol (ISO)

PCB138 (EXP,ISO)

resveratrol (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triclosan (ISO)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of cell-substrate adhesion (IBA,IEA,ISO)

positive regulation of p38MAPK cascade (IBA,IEA,ISO,ISS)

Cellular Component

basement membrane (ISO)

extracellular matrix (ISO)

membrane (IEA)

plasma membrane (IEA)

Molecular Function

collagen binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:18757743	PMID:28688764

Genomics

Comparative Map Data

Rell2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	30,041,204 - 30,045,193 (+)	NCBI		GRCr8
mRatBN7.2	18	29,789,996 - 29,793,986 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	29,790,415 - 29,793,986 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	29,894,721 - 29,898,291 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	30,656,919 - 30,660,489 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	29,992,265 - 29,995,834 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	31,094,965 - 31,098,536 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	31,094,965 - 31,098,536 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	30,783,005 - 30,786,576 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	30,876,604 - 30,880,175 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	30,903,249 - 30,906,821 (+)	NCBI
Celera	18	29,435,000 - 29,438,570 (+)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

RELL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	141,636,997 - 141,641,064 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	141,636,950 - 141,641,064 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	141,016,564 - 141,020,631 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	140,996,779 - 141,000,815 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	140,996,776 - 141,000,814	NCBI
Celera	5	137,093,245 - 137,097,359 (+)	NCBI		Celera
Cytogenetic Map	5	q31.3	NCBI
HuRef	5	136,161,024 - 136,165,138 (+)	NCBI		HuRef
CHM1_1	5	140,449,798 - 140,453,912 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	142,163,003 - 142,167,070 (+)	NCBI		T2T-CHM13v2.0

Rell2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	38,088,107 - 38,092,232 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	38,088,132 - 38,092,232 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	37,955,054 - 37,959,179 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	37,955,079 - 37,959,179 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	38,115,213 - 38,118,833 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	38,081,601 - 38,085,137 (+)	NCBI		MGSCv36	mm8
Celera	18	39,298,873 - 39,302,563 (+)	NCBI		Celera
Cytogenetic Map	18	B3	NCBI
cM Map	18	19.83	NCBI

Rell2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	12,134,642 - 12,138,065 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	12,134,642 - 12,138,071 (-)	NCBI	ChiLan1.0	ChiLan1.0

RELL2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	136,885,813 - 136,890,857 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	135,025,978 - 135,030,149 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	136,997,811 - 137,002,695 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	143,110,407 - 143,114,522 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	143,110,359 - 143,118,157 (+)	Ensembl	panpan1.1		panPan2

RELL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	36,598,175 - 36,602,607 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	36,599,149 - 36,602,020 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	33,649,788 - 33,655,890 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	37,052,095 - 37,058,190 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	37,052,101 - 37,056,135 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	34,126,592 - 34,132,694 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	34,938,124 - 34,944,312 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	35,745,408 - 35,751,510 (+)	NCBI		UU_Cfam_GSD_1.0

Rell2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	150,946,282 - 150,955,942 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	12,522,701 - 12,529,954 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	12,520,262 - 12,530,482 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RELL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	143,288,004 - 143,293,031 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	143,287,507 - 143,291,683 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	149,490,129 - 149,494,301 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RELL2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	44,263,226 - 44,267,358 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	44,264,570 - 44,266,734 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	33,585,280 - 33,589,464 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rell2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	864,498 - 867,803 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	863,924 - 876,610 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rell2
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	273
Count of miRNA genes:	150
Interacting mature miRNAs:	167
Transcripts:	ENSRNOT00000026526
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	18234564	31359530	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	18234564	31359530	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat

Markers in Region

BF417177

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	29,793,700 - 29,793,946 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	31,098,251 - 31,098,496	NCBI	Rnor6.0
Rnor_5.0	18	30,786,291 - 30,786,536	UniSTS	Rnor5.0
RGSC_v3.4	18	30,879,890 - 30,880,135	UniSTS	RGSC3.4
Celera	18	29,438,285 - 29,438,530	UniSTS
RH 3.4 Map	18	444.4	UniSTS
Cytogenetic Map	18	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	nervous system	renal system	reproductive system	respiratory system
High
Medium							51		1
Low		10	8	8	1	8	23	14	28
Below cutoff	3	22	34	25	16	25		20	10	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC089946	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000026526 ⟹ ENSRNOP00000026526

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	29,790,415 - 29,793,986 (+)	Ensembl
Rnor_6.0 Ensembl	18	31,094,965 - 31,098,536 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108230 ⟹ ENSRNOP00000077845

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	29,790,415 - 29,793,601 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110553 ⟹ ENSRNOP00000079487

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	29,790,415 - 29,793,986 (+)	Ensembl

RefSeq Acc Id:

NM_001014149 ⟹ NP_001014171

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	30,041,623 - 30,045,193 (+)	NCBI
mRatBN7.2	18	29,790,415 - 29,793,986 (+)	NCBI
Rnor_6.0	18	31,094,965 - 31,098,536 (+)	NCBI
Rnor_5.0	18	30,783,005 - 30,786,576 (+)	NCBI
RGSC_v3.4	18	30,876,604 - 30,880,175 (+)	RGD
Celera	18	29,435,000 - 29,438,570 (+)	RGD

Sequence:

show sequence

GTCCCAGGCCCGCAACGCGAGTAGGCATTTGGGAACCCAGGACGGTTTCGGAGGTGCCCCCATC
CCCGCCCCCATCCCCTCCATTTCCCTGGCCGGAGTGGTCCGGAGCCTGTCGCGGTTCCCAACTG
GCCCACATCATTCCCTCCCCCCGTCTGCCGCGGCACCGGTATCCGCAGCCACCAGCCCGGAACC
GGTGAGGCGGCAAAGGGGGGAGGGGGAAGAAGCAAGGGATGAGCTCCGGGAGGGCGTCGGGGGC
CCTGAGCCGGACGAGGACGCCCCTGGAGCCGGGACCCGAGCCGGAGCCGGAGCCGGAGACAGAA
CCAAACCACCGGTACCGGCTGCAGCCCACTAAACCCAGGAGGCGCCCTGGCCCGCGCTCGCCCC
CCAGGGCCTCATGTCGGAACCACAGCCTGGCCTGGAGCCGCCCCAACATGGGCTGTACATGCTC
TTCCTGCTTGTGCTGGTCTTCTTCCTCATGGGCCTTGTAGGCTTCATGATCTGCCACGTGCTCA
AGAAGAAAGGCTACCGCTGTCGCACATCTAGGGGCTCAGAGCCTGATGATGCCCAGCTCCAGCC
CCCTGAAGACGATGACGTGAATGAGGACACAGTAGAGCGGATTGTTCGCTGCATCATCCAAAAT
GAAGCCAATGCTGAGGCCTTGAAGGAGATGCTAGGGGACAGTGAAGGAGAAGGGACGGTACAGC
TCTCCAGTGTGGATGCCACCTCCAGCCTGCAGGATGGAGCCCCTTCTCATCATCACACAGTACA
CCTTGGCTCTGCAGCTCCTTGCATCCACTGCAGCCGCAGCAAGAGGCCCCCACTTGTCCGCCAG
GGTCGCTCTAAGGAAGGAAAAGGCCGCCCAAGACCTGGAGAGACCACTGTATTCTCAGTGGGCA
GATTCCGAGTGACACACATTGAGAAGCGCTATGGCCTTCATGAACACCGTGATGGTTCCCCTAC
AGACAGAAGCTGGGGCTCTGGTGGAGGACAGGAACCAGGGGTTAGTCAGGTGGCTGGAGGGCAG
CCTAGGACAGGGACAGCTGCCATTGAGAGGCTGCTCCCTGAGCCACCACCCTCCCAGGCCGCAG
CCACCCACCCAGTGCAGAATGGAAGACTCAAGGATGCCAGCCTAGTCCCTTGTACACTTGAGGG
GACCCCTGGTACCTCTGCAGAACTGAACGTGGGCACTAGAGGGACAGGCCCAAGCCCAGGGCTG
CCTAGTCAAGAAGCAAATGGACAGCCAACCAAACTGGACACCTCAGGTCAGCAGGACTCTCTAC
CACCAGAAGCAGGGGGTATGTGAGGCGAGTCTCCCTGAGCTCGAGATCAGCCTCAGTCTTCACT
GTGCTGATGGATTACCAGCAGGCATTGCCAGGGGACAGCCAGCCAGGAAGACTCTCCCCTCCGC
TGGCCAGCTCTGCCGCTCAGCTGAGGGACCAGCTCTACTTCATCTGGAGATGGTCCTGACTGAG
GGACCTCAGGAGGAGCCCCTCGCACTTCCTGGCCCCTCATCTTTTCCCTTTCCCCACCTGCCAA
CAGGTTGCCTGGCCTGCCTTCCCCAAAACCTCGCTCCACATGCTAGAGCGTGGCAGCTGGGACC
AGGCCCTACCCTCGGTGGGCCCCTAAAGCAATAGCACCTTAGGCTCCCTGCCGTCTTGGCACAA
GAGGCCCAAGCCCTGTCTTGGACTTCATACCCTTTATTCACTGTCAATAAATCCGCTCAGACCA
TTACAGTTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039096962 ⟹ XP_038952890

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	30,041,204 - 30,045,190 (+)	NCBI
mRatBN7.2	18	29,789,996 - 29,793,981 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014171	(Get FASTA)	NCBI Sequence Viewer
	XP_038952890	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89946	(Get FASTA)	NCBI Sequence Viewer
	EDL76420	(Get FASTA)	NCBI Sequence Viewer
	EDL76421	(Get FASTA)	NCBI Sequence Viewer
	EDL76422	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026526
	ENSRNOP00000026526.3
	ENSRNOP00000077845
	ENSRNOP00000077845.1
	ENSRNOP00000079487.1
	ENSRNOP00055034587
	ENSRNOP00060031119
	ENSRNOP00065016308
GenBank Protein	Q5FVJ4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014171 ⟸ NM_001014149

- UniProtKB:

Q5FVJ4 (UniProtKB/Swiss-Prot), A6J3D8 (UniProtKB/TrEMBL), A6J3D9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSEPQPGLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQPPED
DDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGS
AAPCIHCSRSKRPPLVRQGRSKEGKGRPRPGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRS
WGSGGGQEPGVSQVAGGQPRTGTAAIERLLPEPPPSQAAATHPVQNGRLKDASLVPCTLEGTPG
TSAELNVGTRGTGPSPGLPSQEANGQPTKLDTSGQQDSLPPEAGGM

hide sequence

RefSeq Acc Id:

ENSRNOP00000026526 ⟸ ENSRNOT00000026526

RefSeq Acc Id:	XP_038952890 ⟸ XM_039096962
- Peptide Label:	isoform X1
- UniProtKB:	A6J3E0 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000079487 ⟸ ENSRNOT00000110553

RefSeq Acc Id:

ENSRNOP00000077845 ⟸ ENSRNOT00000108230

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5FVJ4-F1-model_v2	AlphaFold	Q5FVJ4	1-302	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305276	AgrOrtholog
BioCyc Gene	G2FUF-7788	BioCyc
Ensembl Genes	ENSRNOG00000019575	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055024597	UniProtKB/Swiss-Prot
	ENSRNOG00060021732	UniProtKB/Swiss-Prot
	ENSRNOG00065012922	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026526	ENTREZGENE
	ENSRNOT00000026526.6	UniProtKB/Swiss-Prot
	ENSRNOT00000108230.1	UniProtKB/TrEMBL
	ENSRNOT00000110553.1	UniProtKB/TrEMBL
	ENSRNOT00055042355	UniProtKB/Swiss-Prot
	ENSRNOT00060037725	UniProtKB/Swiss-Prot
	ENSRNOT00065021142	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7311493	IMAGE-MGC_LOAD
InterPro	RELL2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TNF_rcpt_RELT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:361313	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:109265	IMAGE-MGC_LOAD
NCBI Gene	361313	ENTREZGENE
PANTHER	PTHR31481	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RELT-LIKE PROTEIN 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RELT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rell2	PhenoGen
RatGTEx	ENSRNOG00000019575	RatGTEx
	ENSRNOG00055024597	RatGTEx
	ENSRNOG00060021732	RatGTEx
	ENSRNOG00065012922	RatGTEx
UniProt	A0A8I5Y6T1_RAT	UniProtKB/TrEMBL
	A0A8I5ZN38_RAT	UniProtKB/TrEMBL
	A6J3D8	ENTREZGENE, UniProtKB/TrEMBL
	A6J3D9	ENTREZGENE, UniProtKB/TrEMBL
	A6J3E0	ENTREZGENE, UniProtKB/TrEMBL
	Q5FVJ4	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Rell2	RELT-like 2	RGD1305276	similar to RIKEN cDNA 4631403P03	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1305276	similar to RIKEN cDNA 4631403P03	RGD1305276_predicted	similar to RIKEN cDNA 4631403P03 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1305276_predicted	similar to RIKEN cDNA 4631403P03 (predicted)	LOC361313_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC361313_predicted	similar to RIKEN cDNA 4631403P03 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar