Rhoc (ras homolog family member C)

Gene: Rhoc (ras homolog family member C) Rattus norvegicus

Analyze

Symbol:

Rhoc

Name:

ras homolog family member C

RGD ID:

1304965

Description:

Predicted to enable GTP binding activity; GTPase activity; and protein kinase binding activity. Predicted to be involved in several processes, including positive regulation of canonical NF-kappaB signal transduction; positive regulation of cellular component biogenesis; and skeletal muscle satellite cell migration. Located in cytosol and membrane. Orthologous to human RHOC (ras homolog family member C); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC295342; ras homolog gene family, member C; rho-related GTP-binding protein RhoC

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RHOC (ras homolog family member C)	HGNC	HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Rhoc (ras homolog family member C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rhoc (ras homolog family member C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RHOC (ras homolog family member C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RHOC (ras homolog family member C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rhoc (ras homolog family member C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RHOC (ras homolog family member C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RHOC (ras homolog family member C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rhoc (ras homolog family member C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RHOA (ras homolog family member A)	HGNC	OrthoDB
Homo sapiens (human):	EFNB2 (ephrin B2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RHOC (ras homolog family member C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|OMA\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Rhoc (ras homolog family member C)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	rhoca (ras homolog family member Ca)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	rhocb (ras homolog family member Cb)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	RHO1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RHO2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Rho1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	rho-1	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	rhoc	Alliance	DIOPT (OMA\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	194,975,586 - 194,981,637 (+)	NCBI		GRCr8
mRatBN7.2	2	192,287,065 - 192,293,292 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	192,287,130 - 192,295,306 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	199,881,601 - 199,887,650 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	197,753,887 - 197,759,938 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	192,570,831 - 192,576,882 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	207,271,692 - 207,278,010 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	207,271,853 - 207,279,314 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	226,690,856 - 226,697,174 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	200,048,056 - 200,054,107 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	200,010,698 - 200,017,126 (+)	NCBI
Celera	2	184,753,781 - 184,759,832 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amenorrhea (ISO)

breast cancer (ISO)

genetic disease (ISO)

hereditary spastic paraplegia 47 (ISO)

Myocardial Ischemia (ISO)

Neoplasm Metastasis (ISO)

ovarian carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

1-octadec-9-enoylglycero-3-phosphate (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,3',4,4',5,5'-Heptachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2-amino-2-deoxy-D-glucopyranose (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (EXP)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucosamine (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

arsenous acid (ISO)

atorvastatin calcium (ISO)

atrazine (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

beta-D-glucosamine (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

celecoxib (ISO)

chlordecone (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

choline (ISO)

chrysene (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

cycloheximide (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

cytarabine (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (EXP)

dinophysistoxin 1 (ISO)

dioxygen (ISO)

diuron (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

farnesol (ISO)

fenamidone (ISO)

fenthion (ISO)

folic acid (ISO)

formaldehyde (ISO)

fumonisin B1 (ISO)

furan (EXP)

geranylgeraniol (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

indometacin (ISO)

inulin (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead(0) (ISO)

menadione (ISO)

methimazole (EXP)

microcystin-LR (ISO)

Monobutylphthalate (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosodiethylamine (ISO)

naphthalene (ISO)

nickel sulfate (ISO)

orphenadrine (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenanthrene (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

quercetin (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

simvastatin (ISO)

sodium arsenite (ISO)

Soman (EXP)

succimer (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

Tanshinone I (ISO)

terbinafine (ISO)

tetrachloromethane (ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

triadimefon (ISO)

tris(2-butoxyethyl) phosphate (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin filament organization (IBA)

apical junction assembly (ISO)

mitotic cytokinesis (IBA,ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

positive regulation of cell migration (ISO)

positive regulation of protein-containing complex assembly (ISO)

positive regulation of stress fiber assembly (ISO)

regulation of actin cytoskeleton organization (IBA)

Rho protein signal transduction (IEA)

signal transduction (IBA)

skeletal muscle satellite cell migration (ISS)

small GTPase-mediated signal transduction (IEA)

stress fiber assembly (IEA)

wound healing, spreading of cells (ISS)

Cellular Component

cleavage furrow (ISO)

cytosol (IBA,IDA)

dendritic spine (IEA)

lamellipodium (IEA)

membrane (IDA)

nucleus (ISO)

plasma membrane (IBA,ISO)

stereocilium (ISO)

Molecular Function

GTP binding (IBA)

GTPase activity (IBA)

protein binding (ISO)

protein kinase binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Rho GTPases in human breast tumours: expression and mutation analyses and correlation with clinical parameters.	Fritz G, etal., Br J Cancer. 2002 Sep 9;87(6):635-44.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Up-regulation of small GTPases, RhoA and RhoC, is associated with tumor progression in ovarian carcinoma.	Horiuchi A, etal., Lab Invest. 2003 Jun;83(6):861-70.
5.	Extra-nuclear activation of progesterone receptor in regulating arterial smooth muscle cell migration.	Hsu SP, etal., Atherosclerosis. 2011 Jul;217(1):83-9. doi: 10.1016/j.atherosclerosis.2011.02.051. Epub 2011 Mar 10.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:12761501	PMID:15093731	PMID:16236794	PMID:16750170	PMID:19056867	PMID:19199708	PMID:19887681	PMID:20232393	PMID:20974804	PMID:21474314	PMID:23376485
PMID:27269051

Genomics

Comparative Map Data

Rhoc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	194,975,586 - 194,981,637 (+)	NCBI		GRCr8
mRatBN7.2	2	192,287,065 - 192,293,292 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	192,287,130 - 192,295,306 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	199,881,601 - 199,887,650 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	197,753,887 - 197,759,938 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	192,570,831 - 192,576,882 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	207,271,692 - 207,278,010 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	207,271,853 - 207,279,314 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	226,690,856 - 226,697,174 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	200,048,056 - 200,054,107 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	200,010,698 - 200,017,126 (+)	NCBI
Celera	2	184,753,781 - 184,759,832 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

RHOC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	112,701,131 - 112,707,408 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	112,701,127 - 112,707,434 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	113,243,753 - 113,250,030 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	113,045,272 - 113,051,548 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	112,955,796 - 112,961,762	NCBI
Celera	1	111,474,221 - 111,480,469 (-)	NCBI		Celera
Cytogenetic Map	1	p13.2	NCBI
HuRef	1	111,102,116 - 111,108,421 (-)	NCBI		HuRef
CHM1_1	1	113,358,995 - 113,365,227 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	112,713,708 - 112,719,957 (-)	NCBI		T2T-CHM13v2.0

Rhoc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	104,696,350 - 104,701,775 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	104,695,691 - 104,701,775 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	104,789,034 - 104,794,459 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	104,788,375 - 104,794,459 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	104,591,952 - 104,597,377 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	104,917,108 - 104,922,515 (+)	NCBI		MGSCv36	mm8
Celera	3	106,984,393 - 106,989,818 (+)	NCBI		Celera
Cytogenetic Map	3	F2.2	NCBI
cM Map	3	45.86	NCBI

Rhoc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	16,115,095 - 16,117,869 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955435	16,115,095 - 16,117,736 (-)	NCBI	ChiLan1.0	ChiLan1.0

RHOC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	114,328,960 - 114,335,138 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	113,477,089 - 113,483,288 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	115,353,868 - 115,360,036 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	124,993,063 - 124,998,968 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	124,993,063 - 125,001,708 (+)	Ensembl	panpan1.1		panPan2

RHOC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	62,868,373 - 62,872,322 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	62,379,903 - 62,385,777 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	64,039,576 - 64,045,450 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	64,039,594 - 64,046,097 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	62,774,224 - 62,780,085 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	62,832,308 - 62,838,186 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	63,592,021 - 63,597,895 (+)	NCBI		UU_Cfam_GSD_1.0

Rhoc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	16,219,481 - 16,222,601 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936690	1,255,126 - 1,258,288 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RHOC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	107,731,539 - 107,737,705 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	107,731,713 - 107,737,705 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	117,848,790 - 117,854,768 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RHOC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	20,932,533 - 20,938,703 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	20,936,018 - 20,938,284 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	23,749,488 - 23,755,659 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rhoc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	8,479,015 - 8,486,171 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624772	8,481,826 - 8,487,530 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rhoc
34 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	103
Count of miRNA genes:	78
Interacting mature miRNAs:	97
Transcripts:	ENSRNOT00000017254
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	184114274	202447032	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
7488929	Bp366	Blood pressure QTL 366		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	184974550	193094998	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	185876309	219753474	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
10043139	Iddm55	Insulin dependent diabetes mellitus QTL 55	3.1	0.0001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	190602746	192625452	Rat
10043139	Iddm55	Insulin dependent diabetes mellitus QTL 55	3.1	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	190602746	192625452	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat

Markers in Region

RH141102

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	192,292,458 - 192,292,661 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	207,277,177 - 207,277,379	NCBI	Rnor6.0
Rnor_5.0	2	226,696,341 - 226,696,543	UniSTS	Rnor5.0
RGSC_v3.4	2	200,053,274 - 200,053,476	UniSTS	RGSC3.4
Celera	2	184,758,999 - 184,759,201	UniSTS
RH 3.4 Map	2	1349.5	UniSTS
Cytogenetic Map	2	q34	UniSTS

AA850795

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	192,292,095 - 192,292,266 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	207,276,814 - 207,276,984	NCBI	Rnor6.0
Rnor_5.0	2	226,695,978 - 226,696,148	UniSTS	Rnor5.0
RGSC_v3.4	2	200,052,911 - 200,053,081	UniSTS	RGSC3.4
Celera	2	184,758,636 - 184,758,806	UniSTS
RH 3.4 Map	2	1351.4	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	41	28	16	28	6	9	74	35	39	11	6
Low			16	13	3	13	2	2			2		2
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106461	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC134077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC166849	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229396	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000017254 ⟹ ENSRNOP00000017254

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	192,287,194 - 192,292,780 (+)	Ensembl
Rnor_6.0 Ensembl	2	207,271,943 - 207,278,004 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000085355 ⟹ ENSRNOP00000073774

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	192,287,142 - 192,293,287 (+)	Ensembl
Rnor_6.0 Ensembl	2	207,271,853 - 207,279,314 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000120158 ⟹ ENSRNOP00000097112

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	192,287,130 - 192,295,306 (+)	Ensembl

RefSeq Acc Id:

NM_001106461 ⟹ NP_001099931

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	194,975,586 - 194,981,637 (+)	NCBI
mRatBN7.2	2	192,287,241 - 192,293,292 (+)	NCBI
Rnor_6.0	2	207,271,959 - 207,278,010 (+)	NCBI
Rnor_5.0	2	226,690,856 - 226,697,174 (+)	NCBI
RGSC_v3.4	2	200,048,056 - 200,054,107 (+)	RGD
Celera	2	184,753,781 - 184,759,832 (+)	RGD

Sequence:

show sequence

GGAACTGACCTCGGAGGAGAGCACTTTCCTGCTTCCCGGATCGCTCGGGGAACGGCTCAGGAGG
GGGTTCCGGGCGGGGTATGGGAGAGCGTCCTGTGCCGCGGGGCAGGCGCTCTCGCCTCCTGAGC
TCTCGAACCACAGCCCAGAGCCCCTTCCCTTTCTGAGTCTTGCCTCTCCGGACCTCCCTAGCTG
GGCCAGGAACACACTTGGATCTCCCTGAGCGACTCTACCCAGAAGCTCCAGTTCCGGGCGGGGA
TTTCAGTCATGGCCGCAATCCGAAAGAAGCTGGTAATTGTGGGTGATGGCGCCTGCGGGAAGAC
CTGCCTCCTCATCGTCTTCAGCAAGGATCAGTTTCCGGAGGTCTACGTCCCTACTGTCTTTGAG
AACTACATAGCAGACATCGAAGTGGATGGCAAGCAGGTGGAGCTGGCTCTGTGGGACACAGCAG
GGCAAGAAGACTACGATCGCCTGCGGCCTCTCTCCTACCCGGACACTGACGTCATCCTTATGTG
TTTCTCCATTGACAGTCCTGACAGCCTGGAAAACATTCCTGAGAAGTGGACCCCGGAGGTGAAG
CACTTCTGTCCCAATGTGCCCATCATCCTAGTGGGGAATAAGAAGGACCTGAGGCAAGATGAGC
ATACCAGGAGAGAGCTGGCCAAAATGAAACAGGAGCCGGTTCGATCTGAGGAAGGCCGGGACAT
GGCAAACAGGATCAGCGCCTTCGGCTACCTTGAGTGCTCAGCCAAGACTAAGGAAGGGGTGCGG
GAGGTATTTGAGATGGCCACTCGGGCTGGCCTACAGGTCCGGAAGAATAAGCGCCGGAGGGGCT
GTCCCATTCTCTGAATTCCCCAAAGCCTCCTTAACCCTCCCACTCTTCCCTTCACAGGGGTACA
GACCCCCCTCCCCCCATTTCATCCTTGTAGGATTTCATGCTGCCAGTTTCTTTTTTGGTTCCTT
TCTGCCCTGGACTGCATGAGTTTCCCCAGCCCCAAGTGGGGGCTGCTAGGCCCCTTCTCCCTGC
CTCTGGGAACTAGGTTGGTGCCCTGCCCTTCTTTTGCAGGGCTCCTCCTCCTGATGAGGTCCAG
GGGTGGGGTTCTTAGTCCGTTTGGCCTTCCCCATATTACACACCAGCACTTTATATATTTTTGG
CTCACAGGAGGAGTCTAGGATAGGGACTGGGGTTTCTGCTTTGGGTAGTAGCCTTGTATTTGAC
TTTACTTGGTGGGAGGGCAGGACATGAATAAAGGTCAAAGGTTGCACCATG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099931	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66849	(Get FASTA)	NCBI Sequence Viewer
	EDL85453	(Get FASTA)	NCBI Sequence Viewer
	EDL85454	(Get FASTA)	NCBI Sequence Viewer
	EDL85455	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017254.4
	ENSRNOP00000073774.2
	ENSRNOP00000097112.1

RefSeq Acc Id:	NP_001099931 ⟸ NM_001106461
- UniProtKB:	A6K3P6 (UniProtKB/TrEMBL), A0A0G2K6E0 (UniProtKB/TrEMBL), B2RYP0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQE DYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTR RELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPI L hide sequence

RefSeq Acc Id:

ENSRNOP00000073774 ⟸ ENSRNOT00000085355

RefSeq Acc Id:

ENSRNOP00000017254 ⟸ ENSRNOT00000017254

RefSeq Acc Id:

ENSRNOP00000097112 ⟸ ENSRNOT00000120158

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K6E0-F1-model_v2	AlphaFold	A0A0G2K6E0	1-210	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691646

Promoter ID:

EPDNEW_R2162

Type:

multiple initiation site

Name:

Rhoc_1

Description:

ras homolog family member C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	207,271,872 - 207,271,932	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304965	AgrOrtholog
BioCyc Gene	G2FUF-51761	BioCyc
Ensembl Genes	ENSRNOG00000012630	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017254.7	UniProtKB/TrEMBL
	ENSRNOT00000085355.2	UniProtKB/TrEMBL
	ENSRNOT00000120158.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9088252	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/TrEMBL
	Ras_GTPase	UniProtKB/TrEMBL
	Small_GTP_bd	UniProtKB/TrEMBL
	Small_GTPase_Rho	UniProtKB/TrEMBL
KEGG Report	rno:295342	UniProtKB/TrEMBL
MGC_CLONE	MGC:188745	IMAGE-MGC_LOAD
NCBI Gene	295342	ENTREZGENE
PANTHER	PTHR24072	UniProtKB/TrEMBL
	RAS HOMOLOG FAMILY MEMBER C	UniProtKB/TrEMBL
	RHO-RELATED GTP-BINDING PROTEIN RHOC	UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/TrEMBL
PhenoGen	Rhoc	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012630	RatGTEx
	ENSRNOG00000050519	RatGTEx
SMART	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A0G2K6E0	ENTREZGENE
	A0A8I6AN62_RAT	UniProtKB/TrEMBL
	A6K3P6	ENTREZGENE, UniProtKB/TrEMBL
	B2RYP0	ENTREZGENE, UniProtKB/TrEMBL
	F7ERV8_RAT	UniProtKB/TrEMBL
UniProt Secondary	A0A0G2K6E0	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-15	Rhoc	ras homolog family member C	Rhoc	ras homolog gene family, member C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Rhoc	ras homolog gene family, member C	Rhoc_predicted	ras homolog gene family, member C (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Rhoc_predicted	ras homolog gene family, member C (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD