Batf (basic leucine zipper ATF-like transcription factor)

Gene: Batf (basic leucine zipper ATF-like transcription factor) Rattus norvegicus

Analyze

Symbol:

Batf

Name:

basic leucine zipper ATF-like transcription factor

RGD ID:

1304923

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including defense response to protozoan; hemopoiesis; and positive regulation of macromolecule biosynthetic process. Predicted to be located in cytoplasm and nucleoplasm. Predicted to be part of RNA polymerase II transcription regulator complex. Predicted to be active in nucleus. Orthologous to human BATF (basic leucine zipper ATF-like transcription factor); INTERACTS WITH 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B-ATF; B-cell-activating transcription factor; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcriptional factor ATF-like; LOC299206

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	111,084,717 - 111,107,052 (+)	NCBI		GRCr8
mRatBN7.2	6	105,353,715 - 105,376,051 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	105,353,715 - 105,376,051 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	105,523,736 - 105,546,059 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	105,822,615 - 105,844,937 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	105,192,265 - 105,214,586 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	109,562,415 - 109,584,541 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	109,562,587 - 109,584,545 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	118,868,534 - 118,890,817 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	109,793,076 - 109,817,614 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	109,752,161 - 109,821,070 (+)	NCBI
Celera	6	103,181,553 - 103,203,804 (+)	NCBI		Celera
Cytogenetic Map	6	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

chrysene (ISO)

clodronic acid (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (EXP)

dioxygen (ISO)

elemental selenium (ISO)

folic acid (ISO)

genistein (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

L-methionine (ISO)

menadione (ISO)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

pirinixic acid (ISO)

protein kinase inhibitor (ISO)

selenium atom (ISO)

silicon dioxide (EXP,ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

trimellitic anhydride (ISO)

urethane (ISO)

valproic acid (ISO)

vincristine (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

defense response to protozoan (ISO,ISS)

DNA damage response (ISO,ISS)

DNA damage response, signal transduction by p53 class mediator (ISO,ISS)

hematopoietic stem cell differentiation (ISO,ISS)

isotype switching (ISO,ISS)

lymphoid progenitor cell differentiation (ISO,ISS)

myeloid dendritic cell differentiation (ISO,ISS)

positive regulation of cytokine production (ISO,ISS)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA)

T-helper 17 cell differentiation (ISO,ISS)

T-helper 17 cell lineage commitment (ISO,ISS)

T-helper 2 cell differentiation (ISO,ISS)

Cellular Component

cytoplasm (ISO,ISS)

nucleoplasm (IEA,ISO)

nucleus (IBA,ISO,ISS)

RNA polymerase II transcription regulator complex (ISO)

Molecular Function

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO,ISS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

sequence-specific DNA binding (ISO,ISS)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	The myelin vacuolation (mv) rat with a null mutation in the attractin gene.	Kuwamura M, etal., Lab Invest 2002 Oct;82(10):1279-86.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:19578362	PMID:20421391	PMID:21572431	PMID:22385964	PMID:22983707	PMID:22992523	PMID:22992524	PMID:27073891	PMID:30498928

Genomics

Comparative Map Data

Batf
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	111,084,717 - 111,107,052 (+)	NCBI		GRCr8
mRatBN7.2	6	105,353,715 - 105,376,051 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	105,353,715 - 105,376,051 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	105,523,736 - 105,546,059 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	105,822,615 - 105,844,937 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	105,192,265 - 105,214,586 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	109,562,415 - 109,584,541 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	109,562,587 - 109,584,545 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	118,868,534 - 118,890,817 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	109,793,076 - 109,817,614 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	109,752,161 - 109,821,070 (+)	NCBI
Celera	6	103,181,553 - 103,203,804 (+)	NCBI		Celera
Cytogenetic Map	6	q31	NCBI

BATF
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	75,522,469 - 75,546,992 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	75,522,455 - 75,546,993 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	75,988,812 - 76,013,335 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	75,058,537 - 75,083,086 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	75,058,536 - 75,083,086	NCBI
Celera	14	56,026,856 - 56,051,425 (+)	NCBI		Celera
Cytogenetic Map	14	q24.3	NCBI
HuRef	14	56,156,725 - 56,181,293 (+)	NCBI		HuRef
CHM1_1	14	75,926,564 - 75,951,110 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	69,731,553 - 69,756,105 (+)	NCBI		T2T-CHM13v2.0

Batf
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	85,733,494 - 85,755,861 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	85,733,443 - 85,755,861 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	85,686,720 - 85,709,087 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	85,686,669 - 85,709,087 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	87,027,670 - 87,050,037 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	86,575,823 - 86,598,190 (+)	NCBI		MGSCv36	mm8
Celera	12	87,146,468 - 87,168,966 (+)	NCBI		Celera
Cytogenetic Map	12	D2	NCBI
cM Map	12	39.78	NCBI

Batf
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955523	42,218 - 66,103 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955523	42,365 - 66,103 (-)	NCBI	ChiLan1.0	ChiLan1.0

BATF
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	76,606,588 - 76,631,386 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	75,822,909 - 75,847,891 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	56,075,768 - 56,100,749 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	74,919,115 - 74,943,652 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	74,919,115 - 74,943,652 (+)	Ensembl	panpan1.1		panPan2

BATF
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	48,537,036 - 48,561,154 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	48,220,828 - 48,244,133 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	48,762,172 - 48,785,468 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	48,762,223 - 48,785,160 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	48,435,017 - 48,458,307 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	48,456,502 - 48,479,787 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	48,852,769 - 48,876,074 (+)	NCBI		UU_Cfam_GSD_1.0

Batf
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	27,437,717 - 27,461,255 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936488	4,607,716 - 4,631,283 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936488	4,607,716 - 4,631,237 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BATF
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	98,670,211 - 98,692,230 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	98,670,211 - 98,692,230 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	104,503,160 - 104,524,738 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BATF
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	52,761,569 - 52,785,999 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	52,761,651 - 52,785,978 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	40,981,105 - 41,005,400 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Batf
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	26,118,754 - 26,139,468 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	26,118,840 - 26,139,328 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Batf
52 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	175
Count of miRNA genes:	127
Interacting mature miRNAs:	144
Transcripts:	ENSRNOT00000011563
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	83190345	106747639	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
1300076	Glom8	Glomerulus QTL 8	7	0.000000009	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	89762877	106752806	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	93701310	128713626	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
1331797	Bp213	Blood pressure QTL 213	3.291		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	104085867	128713626	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2		6		15							1
Low		4	41	33	4	33	1	1		34	30	10	1
Below cutoff	1	37	10	8		8	7	9	52	1	10		7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106748	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764758	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000011563 ⟹ ENSRNOP00000011563

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	105,353,715 - 105,376,051 (+)	Ensembl
Rnor_6.0 Ensembl	6	109,562,587 - 109,584,545 (+)	Ensembl

RefSeq Acc Id:

NM_001106748 ⟹ NP_001100218

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	111,084,717 - 111,107,052 (+)	NCBI
mRatBN7.2	6	105,353,715 - 105,376,051 (+)	NCBI
Rnor_6.0	6	109,562,617 - 109,584,541 (+)	NCBI
Rnor_5.0	6	118,868,534 - 118,890,817 (+)	NCBI
RGSC_v3.4	6	109,793,076 - 109,817,614 (+)	RGD
Celera	6	103,181,553 - 103,203,804 (+)	RGD

Sequence:

show sequence

GCCTGTGCGCAAGCCCCAAAGTGAGCGAGATGTCCCTGTGGGGAGCAGTCCCTCTGCACCCCAG
AGAGAGGAGGACGCAGGGGTCTATCGGAGATAGCTGCAGGACGAGCAGGGGAGGCACCTGTGGA
AGGTGGTACGCTGCTGGCCCCCTGGCAGTCAAGAAGGGGAGCTTGCTAGTGAGAAGATCGCCCA
GAGGCATCTGGGACAGTGTGGGAGAGTCCGGAAGATTACAACCATGCCTCACAGCTCCGACAGC
AGCGACTCCAGCTTCAGCCGCTCTCCTCCCCCCGGCAAGCAGGACTCATCCGATGATGTGAGGA
AAGTTCAGAGGAGAGAGAAGAACCGCATTGCTGCCCAGAAGAGCCGACAGAGACAGACACAGAA
GGCCGACACCCTTCACCTGGAGAGCGAGGACCTGGAGAAACAGAATGCGGCTCTTCGAAAAGAG
ATCAAACAGCTCACAGAGGAGCTAAAGTACTTCACATCGGTGCTGAGCAGCCACGAGCCCCTGT
GCTCCGTGCTAGCCAGTGGCACCCCCTCGCCCCCCGAGGTGGTATACAGCGCCCATGCCTTCCA
CCAGCCTCACATCAGCTCACCACGCTTCCAGCCCTGAGCTTCTGGATGAGAAGAGAACAAAGCC
ATGGTCGATGCTACTCCTGTGATCCTATGGAGGGGCCATGCAAACTGAGGCCAGGCTGCCCTCA
TACCTCTATCCAGAGGCCCAGTGACAGAGGCCTGGACAAATATTGAACACAAGGACCATAGTGG
TCCAAGAGACATGAGGCATCCCGGGAAAGTATAGTCAATGTACTGAACTCTCCCGGGGAAATCT
AGCCCATGTACTGGACCCAGAAACTGACGAAACAACCCTGGAGTGTCAGTGTCGCCAATTATGC
CCAAGATGCAACGCACAGAGGGAGGAGGGCAGGGGATGTAGAGTTTTCTAAATAAATATTTTCC
AAGAAACAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100218	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D4A7E1	(Get FASTA)	NCBI Sequence Viewer
	EDL81581	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011563
	ENSRNOP00000011563.4
	ENSRNOP00055038874
	ENSRNOP00060024150
	ENSRNOP00065035311

RefSeq Acc Id:	NP_001100218 ⟸ NM_001106748
- UniProtKB:	D4A7E1 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQ NAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISSPRFQP hide sequence

RefSeq Acc Id:

ENSRNOP00000011563 ⟸ ENSRNOT00000011563

Protein Domains

bZIP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A7E1-F1-model_v2	AlphaFold	D4A7E1	1-125	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304923	AgrOrtholog
BioCyc Gene	G2FUF-36775	BioCyc
Ensembl Genes	ENSRNOG00000008588	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055027330	UniProtKB/Swiss-Prot
	ENSRNOG00060017528	UniProtKB/Swiss-Prot
	ENSRNOG00065025069	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000011563	ENTREZGENE
	ENSRNOT00000011563.8	UniProtKB/Swiss-Prot
	ENSRNOT00055047294	UniProtKB/Swiss-Prot
	ENSRNOT00060029941	UniProtKB/Swiss-Prot
	ENSRNOT00065043114	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.170	UniProtKB/Swiss-Prot
InterPro	AP-1	UniProtKB/Swiss-Prot
	bZIP	UniProtKB/Swiss-Prot
	bZIP_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:299206	UniProtKB/Swiss-Prot
NCBI Gene	299206	ENTREZGENE
PANTHER	PTHR23351	UniProtKB/Swiss-Prot
	PTHR23351:SF14	UniProtKB/Swiss-Prot
Pfam	bZIP_1	UniProtKB/Swiss-Prot
PhenoGen	Batf	PhenoGen
PRINTS	LEUZIPPRFOS	UniProtKB/Swiss-Prot
PROSITE	BZIP	UniProtKB/Swiss-Prot
	BZIP_BASIC	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008588	RatGTEx
	ENSRNOG00055027330	RatGTEx
	ENSRNOG00060017528	RatGTEx
	ENSRNOG00065025069	RatGTEx
SMART	BRLZ	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57959	UniProtKB/Swiss-Prot
UniProt	BATF_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Batf	basic leucine zipper ATF-like transcription factor	Batf	basic leucine zipper transcription factor, ATF-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Batf	basic leucine zipper transcription factor, ATF-like	Batf_predicted	basic leucine zipper transcription factor, ATF-like (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Batf_predicted	basic leucine zipper transcription factor, ATF-like (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar