Pon3 (paraoxonase 3) - Rat Genome Database

Name: Pon3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Pon3 (paraoxonase 3) Rattus norvegicus

Analyze

Symbol:

Pon3

Name:

paraoxonase 3

RGD ID:

1302965

Description:

Enables 3,4-dihydrocoumarin hydrolase activity and arylesterase activity. Involved in coumarin catabolic process and phenylacetate catabolic process. Located in extracellular space. Human ortholog(s) of this gene implicated in Alzheimer's disease; amyotrophic lateral sclerosis; and atherosclerosis. Orthologous to human PON3 (paraoxonase 3); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC95026; serum paraoxonase/lactonase 3

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PON3 (paraoxonase 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pon3 (paraoxonase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pon3 (paraoxonase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PON3 (paraoxonase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PON3 (paraoxonase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pon3 (paraoxonase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PON3 (paraoxonase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PON3 (paraoxonase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pon3 (paraoxonase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	UQCC3 (ubiquinol-cytochrome c reductase complex assembly factor 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PON3 (paraoxonase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pon3 (paraoxonase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pon2 (paraoxonase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pon3.2 (paraoxonase 3, tandem duplicate 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pon1 (paraoxonase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pon3.1 (paraoxonase 3, tandem duplicate 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mec-6	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	poml-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	poml-2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	poml-3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	poml-4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pon2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)

Allele / Splice:

Pon3^em1Mcwi

Genetic Models:

SS-Pon3^em1Mcwi

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	34,323,546 - 34,350,244 (-)	NCBI		GRCr8
mRatBN7.2	4	33,356,983 - 33,383,681 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	33,349,168 - 33,383,855 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	38,316,014 - 38,342,716 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	34,242,154 - 34,268,854 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	32,651,934 - 32,678,640 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	30,311,981 - 30,338,679 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	30,311,982 - 30,338,679 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	30,218,888 - 30,245,586 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	30,000,505 - 30,027,203 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	30,039,834 - 30,066,533 (-)	NCBI
Celera	4	28,883,809 - 28,910,507 (-)	NCBI		Celera
Cytogenetic Map	4	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

amyotrophic lateral sclerosis (ISO)

atherosclerosis (ISO)

autism spectrum disorder (ISO)

celiac disease (ISO)

Crohn's disease (ISO)

genetic disease (ISO)

pleomorphic xanthoastrocytoma (ISO)

ulcerative colitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3-chloropropane-1,2-diol (EXP)

3-methylcholanthrene (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

7-ketocholesterol (ISO)

8-Br-cAMP (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

bifenthrin (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

clofibrate (EXP)

clozapine (ISO)

cobalt dichloride (EXP,ISO)

coumarins (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

dextran sulfate (ISO)

Diallyl sulfide (ISO)

dicrotophos (ISO)

dioxygen (ISO)

diuron (EXP)

endosulfan (EXP)

epoxiconazole (ISO)

ethylparaben (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

glafenine (EXP)

glutathione (ISO)

inulin (ISO)

iodide salt (EXP)

irinotecan (EXP)

isotretinoin (ISO)

kojic acid (EXP)

lovastatin (ISO)

malonaldehyde (ISO)

menadione (ISO)

methimazole (EXP)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP)

nitrofen (EXP)

O-methyleugenol (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenyl acetate (ISO)

phenylacetic acid (ISO)

phosphatidylcholine (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

rutin (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

spironolactone (ISO)

sulfadimethoxine (EXP)

sulindac (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trichloroethene (EXP)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aromatic compound catabolic process (IEA,ISO)

carboxylic acid catabolic process (IEA,ISO)

coumarin catabolic process (IDA)

establishment of localization in cell (IEA,ISO)

negative regulation of superoxide anion generation (IEA,ISO)

phenylacetate catabolic process (IDA)

renal sodium ion transport (IEA,ISO)

response to toxic substance (IBA,IEA)

Cellular Component

extracellular space (IBA,IDA,IEA)

Molecular Function

3,4-dihydrocoumarin hydrolase activity (IDA)

acyl-L-homoserine-lactone lactonohydrolase activity (IEA)

aryldialkylphosphatase activity (IEA)

arylesterase activity (IBA,IDA,IEA,ISO)

metal ion binding (IEA)

protein homodimerization activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Polymorphisms in the PON gene cluster are associated with Alzheimer disease.	Erlich PM, etal., Hum Mol Genet. 2006 Jan 1;15(1):77-85. Epub 2005 Nov 30.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Identification of paraoxonase 3 in rat liver microsomes: purification and biochemical properties.	Rodrigo L, etal., Biochem J 2003 Nov 15;376(Pt 1):261-8.
8.	Modulation of paraoxonase 1 and 3 expression after moderate exercise training in the rat.	Romani R, etal., J Lipid Res. 2009 Oct;50(10):2036-45. Epub 2008 Dec 16.
9.	Paraoxonases are associated with intestinal inflammatory diseases and intracellularly localized to the endoplasmic reticulum.	Rothem L, etal., Free Radic Biol Med. 2007 Sep 1;43(5):730-9. Epub 2007 May 10.
10.	Paraoxonase cluster polymorphisms are associated with sporadic ALS.	Saeed M, etal., Neurology. 2006 Sep 12;67(5):771-6. Epub 2006 Jul 5.
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	Studies on protective effects of human paraoxonases 1 and 3 on atherosclerosis in apolipoprotein E knockout mice.	Zhang C, etal., Gene Ther. 2010 May;17(5):626-33. Epub 2010 Feb 25.

Additional References at PubMed

PMID:15489334	PMID:15772423	PMID:19199708	PMID:22441669

Genomics

Comparative Map Data

Pon3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	34,323,546 - 34,350,244 (-)	NCBI		GRCr8
mRatBN7.2	4	33,356,983 - 33,383,681 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	33,349,168 - 33,383,855 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	38,316,014 - 38,342,716 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	34,242,154 - 34,268,854 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	32,651,934 - 32,678,640 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	30,311,981 - 30,338,679 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	30,311,982 - 30,338,679 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	30,218,888 - 30,245,586 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	30,000,505 - 30,027,203 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	30,039,834 - 30,066,533 (-)	NCBI
Celera	4	28,883,809 - 28,910,507 (-)	NCBI		Celera
Cytogenetic Map	4	q21	NCBI

PON3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	95,359,872 - 95,396,375 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	95,359,872 - 95,396,375 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	94,989,184 - 95,025,687 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	94,827,120 - 94,863,623 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	94,633,925 - 94,670,313	NCBI
Celera	7	89,687,888 - 89,724,394 (-)	NCBI		Celera
Cytogenetic Map	7	q21.3	NCBI
HuRef	7	89,596,240 - 89,632,745 (-)	NCBI		HuRef
CHM1_1	7	94,919,217 - 94,955,721 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	96,596,019 - 96,632,523 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	94,318,186 - 94,354,692 (-)	NCBI

Pon3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	5,216,253 - 5,256,236 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	5,220,852 - 5,256,286 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	5,216,256 - 5,256,285 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	5,220,852 - 5,256,286 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	5,170,852 - 5,206,233 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	5,170,852 - 5,206,233 (-)	NCBI		MGSCv36	mm8
Celera	6	5,367,370 - 5,403,410 (-)	NCBI		Celera
Cytogenetic Map	6	A1	NCBI
cM Map	6	1.99	NCBI

Pon3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955432	11,942,922 - 11,983,504 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955432	11,945,383 - 11,983,417 (-)	NCBI	ChiLan1.0	ChiLan1.0

PON3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	113,197,534 - 113,238,696 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	161,462,173 - 161,503,379 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	87,314,788 - 87,354,020 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	100,902,432 - 100,941,611 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	100,902,432 - 100,941,611 (-)	Ensembl	panpan1.1		panPan2

PON3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	20,615,180 - 20,642,807 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	20,565,641 - 20,642,985 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	20,174,181 - 20,202,180 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	20,437,560 - 20,465,291 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	20,437,057 - 20,465,276 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	20,582,215 - 20,609,982 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	20,317,344 - 20,345,279 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	20,574,717 - 20,602,546 (-)	NCBI		UU_Cfam_GSD_1.0

Pon3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	33,933,867 - 33,961,080 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936585	4,902,289 - 4,929,556 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936585	4,902,430 - 4,928,377 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PON3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	74,991,277 - 75,017,942 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	74,983,040 - 75,017,947 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	82,185,788 - 82,193,864 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PON3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	53,645,406 - 53,675,066 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	53,645,384 - 53,674,812 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	50,670,307 - 50,702,561 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pon3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624813	2,022,482 - 2,051,330 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624813	2,023,025 - 2,051,319 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pon3
12 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	44
Count of miRNA genes:	40
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000012050
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	39505420	Rat
634323	Hc2	Hypercalciuria QTL 2	2.15		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	4	210796	45210796	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	9940885	44463908	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10024901	39524530	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
70222	Eae2	Experimental allergic encephalomyelitis QTL 2	4.3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	4	21333343	39505420	Rat
1354665	Stl10	Serum triglyceride level QTL 10	3.57		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21333343	44463908	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
8552803	Bw144	Body weight QTL 144	16		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	22710685	34430484	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
11530004	Niddm71	Non-insulin dependent diabetes mellitus QTL 71		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	4	32584199	52754138	Rat

Markers in Region

D4Got292

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	33,382,730 - 33,382,996 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	30,337,729 - 30,337,994	NCBI	Rnor6.0
Rnor_5.0	4	30,244,636 - 30,244,901	UniSTS	Rnor5.0
RGSC_v3.4	4	30,026,253 - 30,026,518	UniSTS	RGSC3.4
Celera	4	28,909,557 - 28,909,822	UniSTS
Cytogenetic Map	4	q13	UniSTS

RH127405

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	33,357,008 - 33,357,193 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	30,312,007 - 30,312,191	NCBI	Rnor6.0
Rnor_5.0	4	30,218,914 - 30,219,098	UniSTS	Rnor5.0
RGSC_v3.4	4	30,000,531 - 30,000,715	UniSTS	RGSC3.4
Celera	4	28,883,835 - 28,884,019	UniSTS
RH 3.4 Map	4	434.83	UniSTS
Cytogenetic Map	4	q13	UniSTS

Genetic Models

This gene Pon3 is modified in the following models/strains:

SS-Pon3^em1Mcwi

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3		47	37	2	37	2	2		11	9	11	2
Low		27	10	4	17	4	6	9	42	20	32		6
Below cutoff		14							28	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC109666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC124867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218322	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218352	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218880	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218895	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000012050 ⟹ ENSRNOP00000012050

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	33,349,168 - 33,383,681 (-)	Ensembl
Rnor_6.0 Ensembl	4	30,311,982 - 30,338,679 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117208 ⟹ ENSRNOP00000078311

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	33,356,984 - 33,383,855 (-)	Ensembl

RefSeq Acc Id:

NM_001004086 ⟹ NP_001004086

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	34,323,546 - 34,350,244 (-)	NCBI
mRatBN7.2	4	33,356,983 - 33,383,681 (-)	NCBI
Rnor_6.0	4	30,311,981 - 30,338,679 (-)	NCBI
Rnor_5.0	4	30,218,888 - 30,245,586 (-)	NCBI
RGSC_v3.4	4	30,000,505 - 30,027,203 (-)	RGD
Celera	4	28,883,809 - 28,910,507 (-)	RGD

Sequence:

show sequence

GGCTCCCAGACACCATGGGGAAGCTAGTGGCGCTGACCGTGCTGGGGGCCAGTTTGGCCTTACT
GGGGGAAAGGCTTCTGAATTTTAGAGAACGAGTTAGTACCTCTCGAGAAATAAAGCCCACAGAA
CCACAGAACTGCCACTTGATTGAGGGACTTGAGAATGGCTCTGAAGATATTGATATACTTCCTA
GTGGGCTGGCTTTTATCTCCACCGGACTAAAATATCCAGGTATGCCAAGCTTTGCACCAGACAA
GCCAGGAAGAATCTTCCTGATGGATCTGAATGAGCCATACCCAAAGGCACAAGCACTGGAAATC
AGTGATGGGTTCGACCAGGACTCACTGAATCCCCATGGGATCAGCACTTTCATCGACAAAGACA
ACACTGTGTATCTTTATGCTGTGAATCACCCCCACATGGACTCCACGGTGGAGATATTTAAGTT
TGAAGAACAACCGCGTTCTCTCGTCCACCTGAAAACCATAAAACATGAGCTTTTCGAGAGTGTG
AATGACATTGTGGTTCTTGGGCCAGAGCAGTTCTATGCTACAAGAGACCACTACTTTACCAGTC
ATTTCTTGGTACTTCTGGAGATGATCTTGGACCCTCACTGGACTTCTGTTCTTTTCTACAGCCC
CAAAGAGGTCAAAGTAGTAGCCCAAGGATTTAGTTCTGCCAATGGGATCACAGTCTCACTAGAC
CAGAAGTATGTCTATGTAGCTGATGTAACAGCTAAGAACATTCACATAATGAAAAAACACAATA
ATTGGGATTTAACTCCAGTGAAGGTAATTCAGCTGGGCACCTTAGTGGATAACCTGACTGTTGA
TCCAGCCACCGGAGATATTTTGGCAGGATGCCATCCTAACCCCATGAAGCTCTTGATCTATAAC
CCGGAGGATCCCCCAGGATCAGAAGTACTACGCATCCAGGATCCTTTGTCAGATAACCCCCGGG
TGAGCACACTGTATTCGAACAACGGCTCTGTGCTTCAGGGCAGCACCGTGGCTTCTGTGTATCA
TAAAAAAATGCTCATAGGCACAATATTTCACAAAGCTCTCTATTGTGAACTCTAGATCTTCCTA
AAAATCTTTATATTTGACAGAAGTAAAATTGTAATTGTTTGATAAGGGGAACTGTAATTCTTTA
CAATTACCAGTGACAGTATGTATGGCTTTTCTTATGGAGAAAAGTAAGTGAGTATAGAAACTTA
CATACACAAAATCAAGAGTCAGGTTAGTAGCAAGGCAACCAGAAACCCAAGTGTTCTGCTACAT
TTAATATGCCCAACATTCTGTATACGCTGTGATGTGTAGGCTGTGACCATTTAGGTTTCCCACT
CACTTGAACTTGTGCCCCTTGTTATCTATCCAGCAATGTCACCTCCTACACCTGTGATAGTCTG
AGGCTTCTGCAGTCCATAGAAATAAAGAAGCTAGTGGCTAACTAAAAAAAAAAAAAAAAAAAAA
AAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001004086	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79466	(Get FASTA)	NCBI Sequence Viewer
	EDM15020	(Get FASTA)	NCBI Sequence Viewer
	EDM15021	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012050.5
	ENSRNOP00000078311
	ENSRNOP00000078311.1
GenBank Protein	Q68FP2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001004086 ⟸ NM_001004086

- UniProtKB:

Q68FP2 (UniProtKB/Swiss-Prot), A6IDT3 (UniProtKB/TrEMBL), A0A8I5ZKN0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGKLVALTVLGASLALLGERLLNFRERVSTSREIKPTEPQNCHLIEGLENGSEDIDILPSGLAF
ISTGLKYPGMPSFAPDKPGRIFLMDLNEPYPKAQALEISDGFDQDSLNPHGISTFIDKDNTVYL
YAVNHPHMDSTVEIFKFEEQPRSLVHLKTIKHELFESVNDIVVLGPEQFYATRDHYFTSHFLVL
LEMILDPHWTSVLFYSPKEVKVVAQGFSSANGITVSLDQKYVYVADVTAKNIHIMKKHNNWDLT
PVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPGSEVLRIQDPLSDNPRVSTLY
SNNGSVLQGSTVASVYHKKMLIGTIFHKALYCEL

hide sequence

RefSeq Acc Id:

ENSRNOP00000012050 ⟸ ENSRNOT00000012050

RefSeq Acc Id:

ENSRNOP00000078311 ⟸ ENSRNOT00000117208

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q68FP2-F1-model_v2	AlphaFold	Q68FP2	1-354	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692858

Promoter ID:

EPDNEW_R3383

Type:

initiation region

Name:

Pon3_1

Description:

paraoxonase 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	30,338,672 - 30,338,732	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1302965	AgrOrtholog
BioCyc Gene	G2FUF-45711	BioCyc
BioCyc Pathway	PWY3DJ-35471 [L-ascorbate biosynthesis IV (animals, D-glucuronate pathway)]	BioCyc
BioCyc Pathway Image	PWY3DJ-35471	BioCyc
Ensembl Genes	ENSRNOG00000009096	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012050.5	UniProtKB/TrEMBL
	ENSRNOT00000117208	ENTREZGENE
	ENSRNOT00000117208.1	UniProtKB/TrEMBL
Gene3D-CATH	2.120.10.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7122531	IMAGE-MGC_LOAD
InterPro	6-blade_b-propeller_TolB-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Arylesterase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Paraoxonase2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:312086	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:95026	IMAGE-MGC_LOAD
NCBI Gene	312086	ENTREZGENE
PANTHER	PARAOXONASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SERUM PARAOXONASE/LACTONASE 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Arylesterase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pon3	PhenoGen
PRINTS	PARAOXONASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PARAOXONASE2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009096	RatGTEx
Superfamily-SCOP	Calcium-dependent phosphotriesterase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZKN0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q5B7_RAT	UniProtKB/TrEMBL
	A6IDT3	ENTREZGENE, UniProtKB/TrEMBL
	A6IDT4_RAT	UniProtKB/TrEMBL
	PON3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Pon3	paraoxonase 3			Symbol and Name status set to approved	1299863	APPROVED
2005-02-14	Pon3	paraoxonase 3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

BioCyc Pathways